Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G0AT27

Protein Details
Accession A0A0G0AT27    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
90-116EKMAEKMHRKRVERLKRKEKRNKLLNSBasic
NLS Segment(s)
PositionSequence
28-34PKKAFRP
46-112KERAAMAQMKAKEKEMKEEKEEERQRRIQAIRDKRAKKEERERYEKMAEKMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MEAPVEKKIEKTAKPYGMRKNGMQWHAPKKAFRPTKGLSSYEQRTKERAAMAQMKAKEKEMKEEKEEERQRRIQAIRDKRAKKEERERYEKMAEKMHRKRVERLKRKEKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.68
4 0.69
5 0.7
6 0.65
7 0.65
8 0.63
9 0.59
10 0.58
11 0.56
12 0.55
13 0.59
14 0.6
15 0.54
16 0.51
17 0.58
18 0.59
19 0.54
20 0.53
21 0.48
22 0.54
23 0.55
24 0.52
25 0.45
26 0.45
27 0.48
28 0.47
29 0.49
30 0.41
31 0.4
32 0.39
33 0.39
34 0.33
35 0.29
36 0.28
37 0.29
38 0.29
39 0.31
40 0.33
41 0.33
42 0.32
43 0.32
44 0.32
45 0.25
46 0.33
47 0.35
48 0.35
49 0.35
50 0.41
51 0.41
52 0.46
53 0.54
54 0.49
55 0.49
56 0.5
57 0.49
58 0.49
59 0.49
60 0.47
61 0.49
62 0.54
63 0.57
64 0.63
65 0.66
66 0.65
67 0.74
68 0.73
69 0.73
70 0.73
71 0.75
72 0.74
73 0.78
74 0.76
75 0.72
76 0.73
77 0.7
78 0.62
79 0.6
80 0.58
81 0.61
82 0.65
83 0.69
84 0.69
85 0.67
86 0.74
87 0.76
88 0.8
89 0.8
90 0.82
91 0.83
92 0.85
93 0.92
94 0.93
95 0.93
96 0.93