Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KFC0

Protein Details
Accession Q5KFC0   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
165-197EHTKSPMERLLKKKRRKGYKKTIEHKQGWTRLRBasic
NLS Segment(s)
PositionSequence
173-186RLLKKKRRKGYKKT
Subcellular Location(s) mito 20.5, mito_nucl 14, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG cne:CNF02270  -  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MPRPSISTALARLSIRSLQTSAPLPPPATSLPPSSSVTPIPNLPPLLPSATPSTLPSSTSDALALIKSQSTPSTGRYILARLHARTYLLHPRDILTLPTLKPLQAPGSTLSLTKILEVGSREYSLRSPAAQAKELKKGLTWKEKKTAEFATIPPEVVRCELTVLEHTKSPMERLLKKKRRKGYKKTIEHKQGWTRLRVGDILLGEGNVVKPEGLQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.24
4 0.23
5 0.2
6 0.23
7 0.25
8 0.25
9 0.26
10 0.27
11 0.25
12 0.24
13 0.27
14 0.25
15 0.27
16 0.26
17 0.25
18 0.24
19 0.27
20 0.29
21 0.28
22 0.28
23 0.26
24 0.26
25 0.24
26 0.24
27 0.23
28 0.24
29 0.23
30 0.21
31 0.2
32 0.19
33 0.2
34 0.18
35 0.18
36 0.19
37 0.19
38 0.19
39 0.2
40 0.23
41 0.2
42 0.21
43 0.21
44 0.21
45 0.2
46 0.2
47 0.18
48 0.14
49 0.14
50 0.13
51 0.12
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.1
58 0.11
59 0.13
60 0.17
61 0.17
62 0.18
63 0.18
64 0.19
65 0.18
66 0.23
67 0.25
68 0.21
69 0.23
70 0.22
71 0.22
72 0.21
73 0.24
74 0.27
75 0.25
76 0.25
77 0.24
78 0.24
79 0.25
80 0.25
81 0.21
82 0.13
83 0.14
84 0.14
85 0.17
86 0.16
87 0.14
88 0.13
89 0.14
90 0.15
91 0.12
92 0.13
93 0.11
94 0.13
95 0.13
96 0.13
97 0.13
98 0.11
99 0.11
100 0.09
101 0.09
102 0.07
103 0.08
104 0.09
105 0.1
106 0.1
107 0.11
108 0.11
109 0.11
110 0.12
111 0.12
112 0.12
113 0.1
114 0.12
115 0.16
116 0.19
117 0.22
118 0.27
119 0.28
120 0.35
121 0.35
122 0.33
123 0.3
124 0.34
125 0.37
126 0.43
127 0.46
128 0.43
129 0.52
130 0.55
131 0.55
132 0.53
133 0.49
134 0.42
135 0.38
136 0.34
137 0.3
138 0.27
139 0.26
140 0.21
141 0.19
142 0.16
143 0.14
144 0.14
145 0.09
146 0.1
147 0.1
148 0.11
149 0.15
150 0.17
151 0.17
152 0.18
153 0.18
154 0.2
155 0.2
156 0.21
157 0.22
158 0.26
159 0.33
160 0.42
161 0.53
162 0.6
163 0.69
164 0.77
165 0.81
166 0.85
167 0.88
168 0.89
169 0.89
170 0.9
171 0.91
172 0.91
173 0.92
174 0.91
175 0.86
176 0.84
177 0.83
178 0.8
179 0.75
180 0.7
181 0.63
182 0.55
183 0.51
184 0.43
185 0.34
186 0.29
187 0.24
188 0.22
189 0.18
190 0.16
191 0.13
192 0.13
193 0.13
194 0.09
195 0.09
196 0.07