Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9XNB6

Protein Details
Accession A0A0F9XNB6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-83EFRTRPSPYRLPRKGKGKGKGKLQPQBasic
NLS Segment(s)
PositionSequence
66-86YRLPRKGKGKGKGKLQPQAKG
Subcellular Location(s) extr 8, mito 5, golg 5, plas 4, vacu 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLSAQAHLVFWALSFISLLAQPLRPSLKEHFDANDEVQGILECAIFCYFVWLCLFIIEFRTRPSPYRLPRKGKGKGKGKLQPQAKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.08
6 0.08
7 0.09
8 0.1
9 0.13
10 0.15
11 0.15
12 0.18
13 0.22
14 0.26
15 0.27
16 0.28
17 0.27
18 0.27
19 0.28
20 0.25
21 0.23
22 0.17
23 0.15
24 0.13
25 0.11
26 0.09
27 0.07
28 0.06
29 0.04
30 0.04
31 0.04
32 0.05
33 0.04
34 0.08
35 0.07
36 0.08
37 0.09
38 0.09
39 0.09
40 0.09
41 0.1
42 0.07
43 0.1
44 0.11
45 0.11
46 0.13
47 0.18
48 0.19
49 0.21
50 0.29
51 0.35
52 0.42
53 0.53
54 0.61
55 0.65
56 0.72
57 0.8
58 0.82
59 0.82
60 0.83
61 0.82
62 0.8
63 0.82
64 0.81
65 0.8
66 0.79