Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6CTK5

Protein Details
Accession Q6CTK5    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
23-42NQFLQKCKKPSKKEYLKIIQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8, cyto_nucl 6.5, mito 6, E.R. 5, nucl 3, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023391  Prot_translocase_SecE_dom_sf  
IPR008158  Translocase_Sec61-g  
IPR001901  Translocase_SecE/Sec61-g  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0008320  F:protein transmembrane transporter activity  
GO:0006605  P:protein targeting  
KEGG kla:KLLA0_C11957g  -  
Pfam View protein in Pfam  
PF00584  SecE  
PROSITE View protein in PROSITE  
PS01067  SECE_SEC61G  
Amino Acid Sequences MAKQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKIIQAVGIGFVAVGVIGYIIKLIHIPIRYLIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.14
5 0.13
6 0.17
7 0.19
8 0.19
9 0.19
10 0.24
11 0.22
12 0.28
13 0.38
14 0.37
15 0.4
16 0.5
17 0.56
18 0.59
19 0.68
20 0.73
21 0.74
22 0.77
23 0.8
24 0.78
25 0.74
26 0.67
27 0.58
28 0.48
29 0.38
30 0.3
31 0.21
32 0.13
33 0.08
34 0.06
35 0.05
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.03
44 0.03
45 0.03
46 0.04
47 0.05
48 0.1
49 0.11
50 0.12