Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9X3Y4

Protein Details
Accession A0A0F9X3Y4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
94-121ADKKKVADKKKVTNKKKVVNKKKAAGDVBasic
NLS Segment(s)
PositionSequence
79-117KKVANKKKVADKKKVADKKKVADKKKVTNKKKVVNKKKA
Subcellular Location(s) cyto 19, nucl 5, mito 2
Family & Domain DBs
Amino Acid Sequences MPALALFCLGDKIPRNSIVPKRILELRAIEHARTAVIYDKELPKRQAFLWVKRASGSAPEEKDGDEEKDGDEEKDGDEKKVANKKKVADKKKVADKKKVADKKKVTNKKKVVNKKKAAGDVESSADPCINMTDNEDSGVDIGSGITDIGSGRANNDSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.39
4 0.47
5 0.5
6 0.5
7 0.47
8 0.47
9 0.5
10 0.47
11 0.42
12 0.38
13 0.33
14 0.36
15 0.36
16 0.32
17 0.27
18 0.26
19 0.23
20 0.19
21 0.17
22 0.14
23 0.13
24 0.15
25 0.18
26 0.25
27 0.31
28 0.36
29 0.39
30 0.35
31 0.37
32 0.36
33 0.42
34 0.41
35 0.42
36 0.47
37 0.45
38 0.44
39 0.42
40 0.42
41 0.32
42 0.3
43 0.27
44 0.23
45 0.22
46 0.23
47 0.23
48 0.22
49 0.24
50 0.21
51 0.18
52 0.13
53 0.12
54 0.11
55 0.12
56 0.12
57 0.1
58 0.09
59 0.08
60 0.08
61 0.13
62 0.13
63 0.12
64 0.12
65 0.13
66 0.19
67 0.27
68 0.3
69 0.3
70 0.34
71 0.38
72 0.48
73 0.56
74 0.58
75 0.6
76 0.63
77 0.66
78 0.73
79 0.77
80 0.73
81 0.73
82 0.71
83 0.69
84 0.72
85 0.73
86 0.69
87 0.7
88 0.72
89 0.72
90 0.77
91 0.8
92 0.77
93 0.79
94 0.82
95 0.81
96 0.84
97 0.85
98 0.85
99 0.85
100 0.85
101 0.82
102 0.8
103 0.77
104 0.7
105 0.62
106 0.54
107 0.45
108 0.4
109 0.33
110 0.27
111 0.2
112 0.17
113 0.14
114 0.11
115 0.1
116 0.09
117 0.08
118 0.11
119 0.14
120 0.14
121 0.15
122 0.15
123 0.14
124 0.13
125 0.13
126 0.09
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.08
137 0.08
138 0.1
139 0.14