Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9XE10

Protein Details
Accession A0A0F9XE10   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-67RGGGGPRRKRGGKKEKKEKGGGPBasic
119-159EKEKEKNKEKGKEKEKEKEKKKEKKKDKKKDKEESKEDEDVBasic
NLS Segment(s)
PositionSequence
36-76GGRRGGRGGRGGGGPRRKRGGKKEKKEKGGGPKRGVIKAAG
105-150KEKEEEEKKKEEEEEKEKEKNKEKGKEKEKEKEKKKEKKKDKKKDK
183-188ARGEKK
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MKGATDVRTFFETTLAVLGRPSGNAVVSGGGGGDGGGRRGGRGGRGGGGPRRKRGGKKEKKEKGGGPKRGVIKAAGVGRGPNGILSQKQLRQYVALGLEAEAKEKEKEEEEKKKEEEEEKEKEKNKEKGKEKEKEKEKKKEKKKDKKKDKEESKEDEDVTMAEPEAEAEVEIVGVPSGAKLRARGEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.12
4 0.11
5 0.13
6 0.12
7 0.12
8 0.13
9 0.1
10 0.1
11 0.1
12 0.1
13 0.09
14 0.08
15 0.08
16 0.06
17 0.05
18 0.05
19 0.04
20 0.05
21 0.05
22 0.05
23 0.07
24 0.07
25 0.08
26 0.1
27 0.11
28 0.12
29 0.15
30 0.16
31 0.17
32 0.2
33 0.24
34 0.29
35 0.38
36 0.41
37 0.42
38 0.48
39 0.52
40 0.57
41 0.64
42 0.68
43 0.69
44 0.75
45 0.82
46 0.84
47 0.85
48 0.84
49 0.8
50 0.8
51 0.79
52 0.76
53 0.69
54 0.65
55 0.62
56 0.57
57 0.51
58 0.4
59 0.3
60 0.26
61 0.24
62 0.2
63 0.16
64 0.15
65 0.14
66 0.14
67 0.12
68 0.08
69 0.07
70 0.07
71 0.07
72 0.1
73 0.13
74 0.16
75 0.2
76 0.21
77 0.21
78 0.21
79 0.21
80 0.2
81 0.17
82 0.14
83 0.1
84 0.09
85 0.11
86 0.1
87 0.1
88 0.08
89 0.08
90 0.09
91 0.09
92 0.1
93 0.1
94 0.17
95 0.24
96 0.34
97 0.38
98 0.43
99 0.43
100 0.44
101 0.45
102 0.44
103 0.43
104 0.4
105 0.43
106 0.43
107 0.49
108 0.52
109 0.56
110 0.59
111 0.6
112 0.63
113 0.65
114 0.69
115 0.73
116 0.77
117 0.79
118 0.79
119 0.8
120 0.82
121 0.83
122 0.83
123 0.84
124 0.85
125 0.87
126 0.89
127 0.91
128 0.92
129 0.93
130 0.94
131 0.95
132 0.95
133 0.96
134 0.96
135 0.96
136 0.96
137 0.95
138 0.92
139 0.89
140 0.85
141 0.78
142 0.68
143 0.57
144 0.46
145 0.36
146 0.29
147 0.21
148 0.14
149 0.09
150 0.08
151 0.08
152 0.08
153 0.07
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.06
165 0.09
166 0.11
167 0.14
168 0.2