Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G0AJD8

Protein Details
Accession A0A0G0AJD8   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
150-176DDAERATNRKTKKKAKKIKLSFDEDEGHydrophilic
NLS Segment(s)
PositionSequence
115-120GGRKRK
154-168RATNRKTKKKAKKIK
Subcellular Location(s) nucl 13.5, mito_nucl 11.833, mito 9, cyto_mito 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSQKINSKNLSYNSSLPPFLAALRAQASSASGPDPILSAQRRGGKKRSSSEEAEDNPLIVDEDGNTVEDFKVNKDGTVEETPIEEAEKDAKDGALDAEQNKTNKGESEPAKASIGGRKRKVGKVIGDDAHNDAAQPSTEKKTEASKKGTDDAERATNRKTKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.34
4 0.31
5 0.26
6 0.23
7 0.21
8 0.14
9 0.14
10 0.15
11 0.16
12 0.14
13 0.13
14 0.15
15 0.12
16 0.13
17 0.11
18 0.09
19 0.09
20 0.09
21 0.1
22 0.09
23 0.14
24 0.15
25 0.16
26 0.21
27 0.29
28 0.34
29 0.39
30 0.47
31 0.48
32 0.54
33 0.6
34 0.63
35 0.61
36 0.59
37 0.58
38 0.57
39 0.52
40 0.49
41 0.41
42 0.33
43 0.27
44 0.23
45 0.19
46 0.12
47 0.09
48 0.04
49 0.06
50 0.06
51 0.07
52 0.06
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.14
59 0.13
60 0.14
61 0.14
62 0.14
63 0.17
64 0.19
65 0.18
66 0.12
67 0.13
68 0.13
69 0.12
70 0.12
71 0.07
72 0.05
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.07
83 0.07
84 0.1
85 0.13
86 0.13
87 0.14
88 0.14
89 0.13
90 0.13
91 0.15
92 0.19
93 0.19
94 0.25
95 0.26
96 0.27
97 0.27
98 0.26
99 0.26
100 0.24
101 0.3
102 0.32
103 0.33
104 0.38
105 0.43
106 0.47
107 0.52
108 0.51
109 0.49
110 0.48
111 0.52
112 0.47
113 0.43
114 0.4
115 0.36
116 0.32
117 0.25
118 0.19
119 0.13
120 0.11
121 0.1
122 0.11
123 0.12
124 0.15
125 0.16
126 0.17
127 0.19
128 0.28
129 0.37
130 0.42
131 0.45
132 0.46
133 0.49
134 0.54
135 0.56
136 0.49
137 0.43
138 0.4
139 0.42
140 0.41
141 0.4
142 0.39
143 0.42
144 0.47
145 0.54
146 0.59
147 0.61
148 0.69
149 0.78
150 0.84
151 0.89
152 0.92
153 0.93
154 0.94
155 0.93
156 0.9