Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G0A9F5

Protein Details
Accession A0A0G0A9F5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
282-309ETNFTRLPKESKKDRAKKAKQAGRSGRMHydrophilic
NLS Segment(s)
PositionSequence
289-306PKESKKDRAKKAKQAGRS
332-353RKEGGAGSGVRAMLEKSRKRGA
359-389PRGSGHQMGERFHKKARLMEIGRGSRGKGRK
Subcellular Location(s) cyto 7.5cyto_nucl 7.5, nucl 6.5, mito 6, extr 3, plas 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MAAATTLPALLASLTQSLSLAQEGTSKISTIDHPKDGISLLDVKNELLLSYLQNLVFLILVKLRNAKSDGKDASKEKDQGLDDAVRTKLVELRLFLEKGARPLEEKLRFSIDRFLRTAEDAQRREKMKEAKASAKTGSSTDESGSGSEDDDEDDDEEDDSEAEDGHSRPQPKRGNLSAAPNMGSLMDDVAIRPAKRDQNDDAPAGVYRPPRRERQVMETTQTREKAARRPMRSHTMEEFVASELSSAPIAEPSIGTTIVQGGRRMKTQQERKDEQERTEYEETNFTRLPKESKKDRAKKAKQAGRSGRMQFGGEEWHNLGEGVDRIDRLTKRKEGGAGSGVRAMLEKSRKRGADTEDGPRGSGHQMGERFHKKARLMEIGRGSRGKGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.1
6 0.1
7 0.09
8 0.08
9 0.12
10 0.13
11 0.16
12 0.16
13 0.15
14 0.15
15 0.17
16 0.22
17 0.27
18 0.32
19 0.31
20 0.32
21 0.32
22 0.33
23 0.31
24 0.26
25 0.2
26 0.21
27 0.19
28 0.22
29 0.22
30 0.2
31 0.21
32 0.2
33 0.18
34 0.12
35 0.12
36 0.09
37 0.12
38 0.15
39 0.13
40 0.13
41 0.13
42 0.12
43 0.11
44 0.11
45 0.1
46 0.1
47 0.12
48 0.13
49 0.19
50 0.19
51 0.23
52 0.26
53 0.32
54 0.32
55 0.39
56 0.43
57 0.43
58 0.48
59 0.48
60 0.5
61 0.51
62 0.5
63 0.43
64 0.44
65 0.39
66 0.35
67 0.35
68 0.32
69 0.26
70 0.27
71 0.26
72 0.2
73 0.19
74 0.18
75 0.18
76 0.18
77 0.2
78 0.17
79 0.2
80 0.24
81 0.24
82 0.23
83 0.25
84 0.23
85 0.24
86 0.25
87 0.23
88 0.2
89 0.24
90 0.33
91 0.34
92 0.35
93 0.33
94 0.37
95 0.37
96 0.37
97 0.42
98 0.37
99 0.35
100 0.34
101 0.33
102 0.28
103 0.3
104 0.33
105 0.33
106 0.37
107 0.36
108 0.39
109 0.43
110 0.45
111 0.44
112 0.46
113 0.46
114 0.43
115 0.49
116 0.5
117 0.53
118 0.54
119 0.56
120 0.5
121 0.43
122 0.38
123 0.3
124 0.28
125 0.21
126 0.17
127 0.15
128 0.15
129 0.13
130 0.13
131 0.13
132 0.1
133 0.09
134 0.08
135 0.08
136 0.07
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.05
146 0.05
147 0.05
148 0.04
149 0.04
150 0.06
151 0.06
152 0.09
153 0.12
154 0.16
155 0.17
156 0.26
157 0.32
158 0.35
159 0.41
160 0.41
161 0.45
162 0.44
163 0.49
164 0.43
165 0.38
166 0.35
167 0.28
168 0.25
169 0.18
170 0.15
171 0.09
172 0.05
173 0.05
174 0.04
175 0.04
176 0.06
177 0.08
178 0.08
179 0.09
180 0.14
181 0.18
182 0.19
183 0.24
184 0.24
185 0.31
186 0.34
187 0.33
188 0.29
189 0.25
190 0.23
191 0.2
192 0.2
193 0.17
194 0.18
195 0.24
196 0.28
197 0.34
198 0.39
199 0.44
200 0.45
201 0.48
202 0.53
203 0.49
204 0.49
205 0.48
206 0.46
207 0.44
208 0.41
209 0.33
210 0.28
211 0.29
212 0.33
213 0.38
214 0.43
215 0.45
216 0.49
217 0.54
218 0.6
219 0.6
220 0.57
221 0.49
222 0.44
223 0.39
224 0.34
225 0.29
226 0.2
227 0.17
228 0.12
229 0.09
230 0.06
231 0.06
232 0.06
233 0.05
234 0.04
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.06
241 0.06
242 0.06
243 0.06
244 0.09
245 0.12
246 0.13
247 0.15
248 0.19
249 0.2
250 0.23
251 0.25
252 0.29
253 0.37
254 0.45
255 0.51
256 0.56
257 0.6
258 0.64
259 0.72
260 0.69
261 0.62
262 0.6
263 0.53
264 0.51
265 0.5
266 0.44
267 0.36
268 0.39
269 0.37
270 0.33
271 0.33
272 0.26
273 0.26
274 0.26
275 0.32
276 0.34
277 0.41
278 0.46
279 0.55
280 0.66
281 0.72
282 0.81
283 0.85
284 0.86
285 0.88
286 0.9
287 0.87
288 0.84
289 0.84
290 0.83
291 0.78
292 0.77
293 0.7
294 0.64
295 0.58
296 0.5
297 0.4
298 0.31
299 0.32
300 0.24
301 0.23
302 0.19
303 0.18
304 0.17
305 0.17
306 0.16
307 0.11
308 0.11
309 0.11
310 0.12
311 0.12
312 0.12
313 0.19
314 0.22
315 0.26
316 0.32
317 0.35
318 0.37
319 0.41
320 0.45
321 0.41
322 0.43
323 0.44
324 0.4
325 0.35
326 0.35
327 0.31
328 0.26
329 0.24
330 0.2
331 0.2
332 0.27
333 0.31
334 0.34
335 0.42
336 0.44
337 0.48
338 0.53
339 0.53
340 0.54
341 0.54
342 0.57
343 0.57
344 0.55
345 0.52
346 0.45
347 0.41
348 0.32
349 0.31
350 0.24
351 0.23
352 0.26
353 0.28
354 0.38
355 0.42
356 0.44
357 0.45
358 0.5
359 0.47
360 0.51
361 0.55
362 0.56
363 0.53
364 0.58
365 0.63
366 0.62
367 0.63
368 0.58
369 0.52