Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9X5J6

Protein Details
Accession A0A0F9X5J6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
243-263ASTVEARREIKKQKKASKESEHydrophilic
NLS Segment(s)
PositionSequence
251-259EIKKQKKAS
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012349  Split_barrel_FMN-bd  
IPR007396  TR_PAI2-type  
Pfam View protein in Pfam  
PF04299  FMN_bind_2  
Amino Acid Sequences MYLRGDHAETDLRVLRQLVRENPLGLFTTAISSPSYPLIQSSHIPFILDVEDESSETELGQLRAHMARANPQSKAIIDEIKERQAAGDNSRTLQQDVLVMFTSAVQHYVTPKFYTATKPVTGKVVGTWNYAAVQIYGKATFYIDPNAEETTAFLNSQIDALSSFNERVTMGYTGEGSRPKPWQVSDAPTPYLNIMKKAIIGVEIKIERMEGKFKMSQEMGDGDTDGVVKGFNDLGTDMGSKMASTVEARREIKKQKKASKESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.28
4 0.35
5 0.36
6 0.37
7 0.39
8 0.38
9 0.37
10 0.35
11 0.31
12 0.24
13 0.19
14 0.14
15 0.15
16 0.13
17 0.14
18 0.13
19 0.11
20 0.12
21 0.14
22 0.14
23 0.12
24 0.13
25 0.14
26 0.16
27 0.18
28 0.21
29 0.23
30 0.22
31 0.23
32 0.21
33 0.2
34 0.19
35 0.16
36 0.12
37 0.09
38 0.1
39 0.09
40 0.1
41 0.09
42 0.08
43 0.07
44 0.09
45 0.09
46 0.09
47 0.1
48 0.09
49 0.11
50 0.12
51 0.13
52 0.14
53 0.12
54 0.2
55 0.28
56 0.31
57 0.29
58 0.3
59 0.3
60 0.29
61 0.31
62 0.25
63 0.2
64 0.18
65 0.24
66 0.25
67 0.27
68 0.27
69 0.23
70 0.22
71 0.23
72 0.24
73 0.21
74 0.25
75 0.22
76 0.23
77 0.27
78 0.27
79 0.22
80 0.2
81 0.17
82 0.14
83 0.13
84 0.13
85 0.1
86 0.09
87 0.09
88 0.09
89 0.09
90 0.07
91 0.07
92 0.06
93 0.06
94 0.09
95 0.11
96 0.12
97 0.12
98 0.13
99 0.13
100 0.14
101 0.18
102 0.19
103 0.21
104 0.22
105 0.23
106 0.23
107 0.25
108 0.23
109 0.2
110 0.17
111 0.19
112 0.17
113 0.17
114 0.16
115 0.14
116 0.14
117 0.14
118 0.12
119 0.07
120 0.06
121 0.06
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.07
128 0.07
129 0.09
130 0.09
131 0.09
132 0.11
133 0.11
134 0.11
135 0.1
136 0.1
137 0.08
138 0.09
139 0.08
140 0.07
141 0.07
142 0.06
143 0.07
144 0.06
145 0.05
146 0.05
147 0.05
148 0.06
149 0.07
150 0.07
151 0.07
152 0.08
153 0.08
154 0.07
155 0.1
156 0.1
157 0.09
158 0.09
159 0.1
160 0.1
161 0.13
162 0.15
163 0.13
164 0.16
165 0.18
166 0.2
167 0.22
168 0.22
169 0.25
170 0.27
171 0.31
172 0.35
173 0.36
174 0.36
175 0.33
176 0.33
177 0.28
178 0.3
179 0.25
180 0.2
181 0.19
182 0.17
183 0.18
184 0.17
185 0.16
186 0.14
187 0.14
188 0.12
189 0.17
190 0.16
191 0.16
192 0.16
193 0.16
194 0.15
195 0.16
196 0.2
197 0.14
198 0.19
199 0.23
200 0.23
201 0.29
202 0.28
203 0.26
204 0.24
205 0.26
206 0.22
207 0.18
208 0.18
209 0.12
210 0.12
211 0.12
212 0.09
213 0.07
214 0.06
215 0.05
216 0.06
217 0.07
218 0.06
219 0.07
220 0.07
221 0.08
222 0.1
223 0.11
224 0.1
225 0.1
226 0.1
227 0.09
228 0.09
229 0.09
230 0.09
231 0.1
232 0.16
233 0.2
234 0.29
235 0.32
236 0.36
237 0.45
238 0.54
239 0.62
240 0.66
241 0.71
242 0.73
243 0.81