Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9XJJ8

Protein Details
Accession A0A0F9XJJ8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-87HSSVKKRCEHCKVVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASLLRTLSLAAGLLRSSQVVKPFAAGSFATATSSPASSWMGWLSKPAVGGTLQQTRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.1
5 0.11
6 0.16
7 0.17
8 0.17
9 0.18
10 0.18
11 0.18
12 0.18
13 0.16
14 0.13
15 0.12
16 0.12
17 0.12
18 0.11
19 0.12
20 0.1
21 0.11
22 0.09
23 0.08
24 0.1
25 0.09
26 0.09
27 0.1
28 0.1
29 0.1
30 0.11
31 0.11
32 0.1
33 0.1
34 0.09
35 0.09
36 0.08
37 0.1
38 0.12
39 0.16
40 0.15
41 0.18
42 0.18
43 0.18
44 0.19
45 0.19
46 0.16
47 0.14
48 0.23
49 0.27
50 0.35
51 0.4
52 0.46
53 0.53
54 0.57
55 0.63
56 0.63
57 0.65
58 0.67
59 0.72
60 0.75
61 0.78
62 0.82
63 0.81
64 0.81
65 0.82
66 0.83
67 0.84
68 0.81
69 0.79
70 0.77
71 0.73
72 0.68
73 0.64
74 0.57
75 0.5
76 0.43
77 0.35
78 0.35
79 0.39
80 0.46
81 0.48
82 0.54