Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9ZNY3

Protein Details
Accession A0A0F9ZNY3    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
191-233ENDNSHTKKRKGGKRKRIVEEDPWLELKKRRGEKKAKVHDVVLBasic
NLS Segment(s)
PositionSequence
44-49KKRARS
198-227KKRKGGKRKRIVEEDPWLELKKRRGEKKAK
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPHKHKSKKGEFEAEFDLAPTEKARSLPVNKRKAASSSGEQVTKKRARSSLRGNDTPRAFKRIMAVAGGKKIRSGLDDGQLDKTTTKATDVTSEKLQIRPGENLGAFASRVDAALPVSGLAKKTSTNAEGKDALGLKVYRTRKERKMHKLYDQWRAEESKIREKREEELERIAERDLEDDAAGILTSAAFENDNSHTKKRKGGKRKRIVEEDPWLELKKRRGEKKAKVHDVVLAPPELHKVELK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.49
3 0.39
4 0.31
5 0.21
6 0.19
7 0.15
8 0.12
9 0.12
10 0.13
11 0.17
12 0.23
13 0.32
14 0.42
15 0.51
16 0.58
17 0.6
18 0.61
19 0.61
20 0.57
21 0.53
22 0.48
23 0.43
24 0.42
25 0.43
26 0.46
27 0.44
28 0.43
29 0.48
30 0.48
31 0.46
32 0.44
33 0.47
34 0.48
35 0.55
36 0.63
37 0.64
38 0.67
39 0.7
40 0.69
41 0.69
42 0.67
43 0.67
44 0.58
45 0.54
46 0.46
47 0.39
48 0.4
49 0.37
50 0.33
51 0.27
52 0.29
53 0.25
54 0.31
55 0.32
56 0.28
57 0.23
58 0.23
59 0.21
60 0.19
61 0.21
62 0.17
63 0.22
64 0.25
65 0.26
66 0.28
67 0.28
68 0.27
69 0.22
70 0.19
71 0.14
72 0.12
73 0.12
74 0.1
75 0.1
76 0.16
77 0.19
78 0.21
79 0.21
80 0.25
81 0.26
82 0.25
83 0.28
84 0.23
85 0.23
86 0.22
87 0.21
88 0.21
89 0.19
90 0.18
91 0.16
92 0.14
93 0.12
94 0.1
95 0.09
96 0.06
97 0.06
98 0.05
99 0.05
100 0.04
101 0.05
102 0.05
103 0.04
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.07
110 0.08
111 0.1
112 0.12
113 0.15
114 0.15
115 0.18
116 0.18
117 0.18
118 0.19
119 0.17
120 0.14
121 0.14
122 0.13
123 0.11
124 0.17
125 0.2
126 0.23
127 0.29
128 0.36
129 0.43
130 0.52
131 0.61
132 0.65
133 0.72
134 0.73
135 0.76
136 0.78
137 0.76
138 0.77
139 0.69
140 0.6
141 0.52
142 0.49
143 0.41
144 0.39
145 0.37
146 0.37
147 0.41
148 0.43
149 0.44
150 0.44
151 0.47
152 0.5
153 0.5
154 0.43
155 0.43
156 0.42
157 0.39
158 0.38
159 0.34
160 0.24
161 0.19
162 0.17
163 0.12
164 0.09
165 0.08
166 0.07
167 0.07
168 0.06
169 0.06
170 0.05
171 0.04
172 0.03
173 0.04
174 0.04
175 0.04
176 0.04
177 0.05
178 0.08
179 0.11
180 0.18
181 0.21
182 0.27
183 0.34
184 0.37
185 0.45
186 0.53
187 0.6
188 0.65
189 0.73
190 0.78
191 0.81
192 0.89
193 0.9
194 0.89
195 0.85
196 0.82
197 0.8
198 0.72
199 0.65
200 0.58
201 0.51
202 0.45
203 0.45
204 0.44
205 0.44
206 0.5
207 0.56
208 0.63
209 0.72
210 0.79
211 0.84
212 0.88
213 0.88
214 0.82
215 0.74
216 0.7
217 0.63
218 0.57
219 0.49
220 0.39
221 0.29
222 0.26
223 0.29
224 0.23