Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9X265

Protein Details
Accession A0A0F9X265    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-32IPKTRNTYCKGKECRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 8, mito 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MAVNIPKTRNTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVKCKTKLQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.77
4 0.77
5 0.83
6 0.82
7 0.85
8 0.85
9 0.86
10 0.84
11 0.85
12 0.88
13 0.81
14 0.8
15 0.74
16 0.69
17 0.61
18 0.55
19 0.45
20 0.36
21 0.34
22 0.34
23 0.33
24 0.29
25 0.34
26 0.38
27 0.42
28 0.47
29 0.52
30 0.48
31 0.55
32 0.62
33 0.59
34 0.61
35 0.59
36 0.58
37 0.57
38 0.59
39 0.5
40 0.44
41 0.4
42 0.33
43 0.35
44 0.36
45 0.35
46 0.3
47 0.37
48 0.41
49 0.5
50 0.58
51 0.61
52 0.61
53 0.64
54 0.71
55 0.72
56 0.71
57 0.66
58 0.63
59 0.64
60 0.64
61 0.63
62 0.58
63 0.55
64 0.5
65 0.49
66 0.48
67 0.46
68 0.49
69 0.53
70 0.58
71 0.61
72 0.7
73 0.74
74 0.75
75 0.71
76 0.64
77 0.58
78 0.5
79 0.49
80 0.49
81 0.5
82 0.51
83 0.54
84 0.51
85 0.49
86 0.48
87 0.42