Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9X0K6

Protein Details
Accession A0A0F9X0K6   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-49GVKKTPGRGRGRPKSANPKSPSBasic
NLS Segment(s)
PositionSequence
30-98KKTPGRGRGRPKSANPKSPSKPYVPTGRPRGRPKGSFKSKAGEERAKKPKKPAAPLAPGQTRGRGRPRK
Subcellular Location(s) nucl 19, cyto_nucl 15, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MARTRDDAKATAADAAADITRQPTEDAGVKKTPGRGRGRPKSANPKSPSKPYVPTGRPRGRPKGSFKSKAGEERAKKPKKPAAPLAPGQTRGRGRPRKSDVVPAQEDNQEQTAESEANAEAEAGDDAAENQPGIGDVTGGARDGTPRQSPEYEVGPSSSFTSPAWFSRFKNIIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.11
4 0.09
5 0.08
6 0.08
7 0.08
8 0.09
9 0.09
10 0.09
11 0.12
12 0.18
13 0.2
14 0.23
15 0.26
16 0.27
17 0.29
18 0.35
19 0.37
20 0.4
21 0.45
22 0.5
23 0.58
24 0.67
25 0.74
26 0.74
27 0.79
28 0.81
29 0.81
30 0.82
31 0.76
32 0.76
33 0.72
34 0.73
35 0.68
36 0.61
37 0.58
38 0.53
39 0.58
40 0.54
41 0.56
42 0.58
43 0.62
44 0.66
45 0.68
46 0.73
47 0.7
48 0.72
49 0.72
50 0.73
51 0.74
52 0.72
53 0.67
54 0.63
55 0.59
56 0.59
57 0.57
58 0.54
59 0.49
60 0.52
61 0.61
62 0.62
63 0.61
64 0.61
65 0.61
66 0.6
67 0.62
68 0.61
69 0.59
70 0.57
71 0.58
72 0.56
73 0.52
74 0.48
75 0.42
76 0.38
77 0.31
78 0.3
79 0.38
80 0.4
81 0.41
82 0.48
83 0.54
84 0.56
85 0.56
86 0.62
87 0.57
88 0.56
89 0.55
90 0.47
91 0.43
92 0.37
93 0.36
94 0.27
95 0.23
96 0.16
97 0.13
98 0.12
99 0.11
100 0.08
101 0.08
102 0.08
103 0.07
104 0.07
105 0.07
106 0.06
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.03
113 0.04
114 0.05
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.05
122 0.04
123 0.04
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.08
130 0.1
131 0.15
132 0.18
133 0.2
134 0.24
135 0.25
136 0.28
137 0.3
138 0.31
139 0.29
140 0.26
141 0.25
142 0.22
143 0.22
144 0.23
145 0.2
146 0.17
147 0.15
148 0.19
149 0.19
150 0.22
151 0.27
152 0.27
153 0.29
154 0.38