Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KFX3

Protein Details
Accession Q5KFX3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
92-111LSGTGARRPRPKPRAAPGTTHydrophilic
392-416EKEAIKEKRKVWRRYARKHLLSPSNHydrophilic
NLS Segment(s)
PositionSequence
90-106RRLSGTGARRPRPKPRA
364-410KDRERMRVAKQKEEAERIKKEREEKERREKEAIKEKRKVWRRYARKH
Subcellular Location(s) cyto 8.5, mito 8, cyto_nucl 7.5, nucl 5.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
IPR006577  UAS  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0043130  F:ubiquitin binding  
GO:0030433  P:ubiquitin-dependent ERAD pathway  
KEGG cne:CNF00270  -  
Amino Acid Sequences MPLTASQQQALSQLWAVTSSATDAARERDERLLRENGWDVQTTVEQIFSMADDANLSSPGDAGPSTSRNRLGAHDPDQDPLLPPIPPGARRLSGTGARRPRPKPRAAPGTTGIGIGIWDIIVWPVGMLFSIVGGVWYFIVRTFVPLSFLPHIPSFLLPPSPSPPSIPRPPQDPTTAHLAFLQSLSSLTGLPPSELPEIYVGPYREFLTHIRKELLVGLIVLVSEEHEDDESFKKGSLADKDVVQALRSEGVIVWAADISSREGYQASQTLLATTYPSLTFLSLLPSTSSLPTTSSSPKLTLLNTLSGPPSTITSPTSIITTLQTAVLPRARPFLNRLKSERLAVEEARYVRAEQDRAFRASEAKDRERMRVAKQKEEAERIKKEREEKERREKEAIKEKRKVWRRYARKHLLSPSNGPIRVALRTPLSSARHLHHFTPSSSTLPLYIFAETLLIPASAKKEDDPDTPPEGYDPLAYLSSSSSDTNANGTRISDIIGEEEVGDWPFTLVTAYPRQTIPCVLAEGEKVWETVQKAGGAMFLEKREGYTFGLSEEEEEGESEEEIVSDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.11
5 0.1
6 0.1
7 0.12
8 0.11
9 0.13
10 0.14
11 0.18
12 0.23
13 0.24
14 0.25
15 0.31
16 0.36
17 0.38
18 0.41
19 0.44
20 0.39
21 0.43
22 0.44
23 0.4
24 0.37
25 0.35
26 0.3
27 0.26
28 0.26
29 0.23
30 0.2
31 0.16
32 0.13
33 0.12
34 0.12
35 0.09
36 0.1
37 0.07
38 0.07
39 0.07
40 0.08
41 0.09
42 0.09
43 0.09
44 0.08
45 0.08
46 0.08
47 0.08
48 0.07
49 0.09
50 0.12
51 0.17
52 0.2
53 0.24
54 0.27
55 0.28
56 0.3
57 0.32
58 0.35
59 0.38
60 0.41
61 0.45
62 0.44
63 0.43
64 0.42
65 0.39
66 0.34
67 0.29
68 0.24
69 0.15
70 0.15
71 0.19
72 0.22
73 0.23
74 0.24
75 0.27
76 0.28
77 0.3
78 0.33
79 0.32
80 0.35
81 0.39
82 0.45
83 0.49
84 0.54
85 0.61
86 0.65
87 0.7
88 0.72
89 0.76
90 0.77
91 0.77
92 0.81
93 0.76
94 0.75
95 0.67
96 0.64
97 0.55
98 0.45
99 0.34
100 0.23
101 0.19
102 0.13
103 0.1
104 0.04
105 0.03
106 0.03
107 0.03
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.07
127 0.07
128 0.09
129 0.11
130 0.11
131 0.14
132 0.14
133 0.19
134 0.2
135 0.21
136 0.21
137 0.2
138 0.2
139 0.18
140 0.18
141 0.15
142 0.13
143 0.15
144 0.13
145 0.15
146 0.18
147 0.2
148 0.2
149 0.22
150 0.26
151 0.3
152 0.39
153 0.43
154 0.42
155 0.44
156 0.46
157 0.47
158 0.47
159 0.41
160 0.35
161 0.37
162 0.35
163 0.3
164 0.28
165 0.25
166 0.19
167 0.18
168 0.16
169 0.07
170 0.07
171 0.07
172 0.06
173 0.06
174 0.05
175 0.08
176 0.08
177 0.08
178 0.09
179 0.11
180 0.12
181 0.12
182 0.13
183 0.11
184 0.12
185 0.12
186 0.16
187 0.13
188 0.12
189 0.14
190 0.14
191 0.13
192 0.15
193 0.18
194 0.23
195 0.25
196 0.27
197 0.27
198 0.26
199 0.26
200 0.26
201 0.23
202 0.14
203 0.11
204 0.09
205 0.07
206 0.07
207 0.06
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.07
216 0.09
217 0.1
218 0.1
219 0.1
220 0.1
221 0.11
222 0.15
223 0.17
224 0.19
225 0.19
226 0.19
227 0.2
228 0.22
229 0.21
230 0.17
231 0.14
232 0.1
233 0.1
234 0.09
235 0.08
236 0.06
237 0.07
238 0.07
239 0.06
240 0.06
241 0.05
242 0.05
243 0.05
244 0.05
245 0.06
246 0.06
247 0.06
248 0.06
249 0.06
250 0.07
251 0.08
252 0.09
253 0.08
254 0.09
255 0.09
256 0.09
257 0.09
258 0.09
259 0.08
260 0.06
261 0.07
262 0.06
263 0.07
264 0.06
265 0.06
266 0.07
267 0.06
268 0.09
269 0.08
270 0.09
271 0.08
272 0.09
273 0.1
274 0.09
275 0.1
276 0.07
277 0.08
278 0.09
279 0.11
280 0.13
281 0.15
282 0.16
283 0.16
284 0.17
285 0.18
286 0.17
287 0.18
288 0.17
289 0.17
290 0.16
291 0.16
292 0.15
293 0.13
294 0.13
295 0.1
296 0.09
297 0.08
298 0.09
299 0.09
300 0.09
301 0.11
302 0.11
303 0.11
304 0.1
305 0.1
306 0.09
307 0.09
308 0.08
309 0.08
310 0.08
311 0.07
312 0.09
313 0.12
314 0.12
315 0.12
316 0.16
317 0.16
318 0.17
319 0.22
320 0.3
321 0.34
322 0.38
323 0.42
324 0.45
325 0.46
326 0.47
327 0.42
328 0.36
329 0.32
330 0.28
331 0.25
332 0.22
333 0.21
334 0.2
335 0.2
336 0.16
337 0.16
338 0.19
339 0.19
340 0.18
341 0.24
342 0.25
343 0.27
344 0.27
345 0.24
346 0.24
347 0.25
348 0.29
349 0.3
350 0.3
351 0.35
352 0.36
353 0.39
354 0.43
355 0.44
356 0.45
357 0.47
358 0.48
359 0.49
360 0.52
361 0.56
362 0.54
363 0.58
364 0.58
365 0.56
366 0.61
367 0.57
368 0.58
369 0.56
370 0.59
371 0.6
372 0.63
373 0.66
374 0.68
375 0.75
376 0.77
377 0.78
378 0.78
379 0.75
380 0.73
381 0.73
382 0.74
383 0.72
384 0.71
385 0.72
386 0.73
387 0.78
388 0.76
389 0.76
390 0.77
391 0.78
392 0.81
393 0.87
394 0.88
395 0.85
396 0.84
397 0.82
398 0.79
399 0.73
400 0.67
401 0.64
402 0.6
403 0.53
404 0.46
405 0.4
406 0.33
407 0.31
408 0.27
409 0.22
410 0.18
411 0.18
412 0.2
413 0.24
414 0.26
415 0.28
416 0.3
417 0.3
418 0.35
419 0.37
420 0.36
421 0.37
422 0.37
423 0.34
424 0.37
425 0.36
426 0.3
427 0.29
428 0.27
429 0.21
430 0.19
431 0.19
432 0.14
433 0.12
434 0.1
435 0.09
436 0.1
437 0.08
438 0.08
439 0.07
440 0.06
441 0.06
442 0.07
443 0.1
444 0.11
445 0.12
446 0.13
447 0.17
448 0.21
449 0.25
450 0.27
451 0.3
452 0.33
453 0.33
454 0.32
455 0.28
456 0.25
457 0.22
458 0.18
459 0.14
460 0.11
461 0.11
462 0.11
463 0.1
464 0.1
465 0.11
466 0.12
467 0.12
468 0.11
469 0.12
470 0.13
471 0.17
472 0.19
473 0.19
474 0.17
475 0.18
476 0.18
477 0.17
478 0.17
479 0.13
480 0.11
481 0.12
482 0.11
483 0.11
484 0.09
485 0.1
486 0.1
487 0.09
488 0.09
489 0.07
490 0.07
491 0.07
492 0.06
493 0.06
494 0.06
495 0.11
496 0.18
497 0.2
498 0.23
499 0.24
500 0.26
501 0.28
502 0.29
503 0.27
504 0.22
505 0.22
506 0.2
507 0.21
508 0.21
509 0.2
510 0.2
511 0.18
512 0.16
513 0.14
514 0.17
515 0.17
516 0.2
517 0.21
518 0.19
519 0.19
520 0.19
521 0.2
522 0.18
523 0.19
524 0.19
525 0.17
526 0.19
527 0.18
528 0.2
529 0.2
530 0.21
531 0.21
532 0.21
533 0.2
534 0.19
535 0.21
536 0.19
537 0.19
538 0.18
539 0.16
540 0.13
541 0.13
542 0.13
543 0.12
544 0.12
545 0.1
546 0.09
547 0.08