Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5KFG9

Protein Details
Accession Q5KFG9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-29LYIKGRILGHKRGKRNSRPNQSLLQHydrophilic
NLS Segment(s)
PositionSequence
14-19HKRGKR
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0042273  P:ribosomal large subunit biogenesis  
KEGG cne:CNF01790  -  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MASRLYIKGRILGHKRGKRNSRPNQSLLQIEGVDNKEAAGHYLGKRVAYVYKAKREINGSRVRVIWGRISRSHGNSGAVKSKFRTNLPAKTFGASCRIMLFPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.69
3 0.73
4 0.79
5 0.81
6 0.85
7 0.86
8 0.87
9 0.85
10 0.81
11 0.76
12 0.7
13 0.61
14 0.52
15 0.43
16 0.32
17 0.26
18 0.25
19 0.21
20 0.17
21 0.15
22 0.13
23 0.11
24 0.1
25 0.11
26 0.08
27 0.1
28 0.11
29 0.15
30 0.15
31 0.15
32 0.15
33 0.15
34 0.15
35 0.14
36 0.21
37 0.22
38 0.29
39 0.33
40 0.33
41 0.34
42 0.38
43 0.39
44 0.39
45 0.43
46 0.38
47 0.36
48 0.36
49 0.35
50 0.31
51 0.3
52 0.29
53 0.24
54 0.26
55 0.27
56 0.32
57 0.35
58 0.37
59 0.39
60 0.34
61 0.34
62 0.33
63 0.34
64 0.36
65 0.33
66 0.31
67 0.29
68 0.34
69 0.35
70 0.34
71 0.41
72 0.4
73 0.48
74 0.51
75 0.56
76 0.51
77 0.5
78 0.49
79 0.41
80 0.4
81 0.32
82 0.27
83 0.23
84 0.22
85 0.2