Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B5RSI6

Protein Details
Accession B5RSI6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTKSYRSRTGIRTKRQTRRLAPPSQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
KEGG kla:KLLA0_A05852g  -  
Amino Acid Sequences MTKSYRSRTGIRTKRQTRRLAPPSQQAKEPDRNVLPTYQYHNQYENQFEPVPITFYYVVFPQGESQNEPDGGTNNSQTHPNPLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.87
4 0.84
5 0.85
6 0.83
7 0.81
8 0.76
9 0.76
10 0.76
11 0.68
12 0.65
13 0.59
14 0.57
15 0.57
16 0.52
17 0.48
18 0.4
19 0.41
20 0.37
21 0.34
22 0.29
23 0.23
24 0.27
25 0.27
26 0.28
27 0.27
28 0.28
29 0.29
30 0.29
31 0.3
32 0.26
33 0.24
34 0.21
35 0.19
36 0.18
37 0.16
38 0.16
39 0.12
40 0.14
41 0.11
42 0.11
43 0.12
44 0.12
45 0.13
46 0.11
47 0.12
48 0.12
49 0.15
50 0.16
51 0.18
52 0.2
53 0.21
54 0.21
55 0.21
56 0.19
57 0.18
58 0.19
59 0.19
60 0.21
61 0.2
62 0.21
63 0.24
64 0.24