Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5KPV1

Protein Details
Accession Q5KPV1    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-34DSELKAVRASKRPERRKKRPKEIVFPDLDBasic
NLS Segment(s)
PositionSequence
12-27VRASKRPERRKKRPKE
45-50RPHRRR
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MYGAEDSELKAVRASKRPERRKKRPKEIVFPDLDLSKIRREVVNRPHRRRSRGAVIQQLKLRCDGPEKSENQVVGVSEAGYEESGIGAGYEARYGSRSAKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.56
4 0.66
5 0.75
6 0.82
7 0.87
8 0.9
9 0.94
10 0.95
11 0.95
12 0.93
13 0.92
14 0.9
15 0.87
16 0.79
17 0.69
18 0.59
19 0.49
20 0.4
21 0.31
22 0.24
23 0.18
24 0.17
25 0.16
26 0.17
27 0.19
28 0.26
29 0.35
30 0.45
31 0.53
32 0.58
33 0.67
34 0.71
35 0.74
36 0.71
37 0.67
38 0.65
39 0.63
40 0.61
41 0.61
42 0.59
43 0.57
44 0.56
45 0.51
46 0.42
47 0.35
48 0.3
49 0.21
50 0.22
51 0.2
52 0.22
53 0.28
54 0.29
55 0.32
56 0.34
57 0.33
58 0.29
59 0.28
60 0.22
61 0.16
62 0.14
63 0.1
64 0.07
65 0.07
66 0.07
67 0.06
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.06
79 0.06
80 0.08
81 0.1