Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9XCH6

Protein Details
Accession A0A0F9XCH6    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
241-261ESEKTEKKSDKKVVTKDQAEDHydrophilic
NLS Segment(s)
PositionSequence
232-236KKRKT
247-248KK
266-273RRSKRLRK
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSSPAVVPHGEISKEQFASCLSQYPSLIEAIPAKNGQKTLSELDQYRYVDAVDTFNLKKPKREMNLDDVKLLVEWKLRHGKFRPTLMSLVSSNPPSASQTIQFAIKFYSSSKDIGSGVRLLSELKGVGPATASLLLSVHDPERVIFFSDEAFYWLCCEGKKAPIKYNPKEYLALRTEAEVLAKRLSVSAMDIEKVAYVLMKKQETTKDSKTVTTAKTKAPVKEPASTSSSAKKRKTASGEESEKTEKKSDKKVVTKDQAEDNASLRRSKRLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.24
4 0.22
5 0.25
6 0.25
7 0.26
8 0.22
9 0.24
10 0.24
11 0.25
12 0.25
13 0.22
14 0.21
15 0.16
16 0.19
17 0.17
18 0.2
19 0.21
20 0.21
21 0.23
22 0.24
23 0.23
24 0.21
25 0.23
26 0.25
27 0.27
28 0.3
29 0.29
30 0.32
31 0.36
32 0.34
33 0.31
34 0.27
35 0.22
36 0.19
37 0.18
38 0.16
39 0.12
40 0.15
41 0.16
42 0.21
43 0.29
44 0.29
45 0.34
46 0.38
47 0.46
48 0.49
49 0.56
50 0.56
51 0.58
52 0.67
53 0.62
54 0.57
55 0.47
56 0.4
57 0.32
58 0.27
59 0.18
60 0.12
61 0.12
62 0.18
63 0.28
64 0.28
65 0.35
66 0.39
67 0.47
68 0.49
69 0.55
70 0.53
71 0.46
72 0.47
73 0.41
74 0.4
75 0.31
76 0.27
77 0.23
78 0.2
79 0.17
80 0.15
81 0.15
82 0.13
83 0.14
84 0.12
85 0.11
86 0.13
87 0.14
88 0.16
89 0.15
90 0.14
91 0.13
92 0.12
93 0.12
94 0.1
95 0.12
96 0.12
97 0.13
98 0.12
99 0.13
100 0.13
101 0.14
102 0.14
103 0.12
104 0.1
105 0.1
106 0.1
107 0.08
108 0.08
109 0.08
110 0.06
111 0.05
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.06
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.05
126 0.05
127 0.05
128 0.06
129 0.07
130 0.07
131 0.09
132 0.08
133 0.08
134 0.08
135 0.09
136 0.08
137 0.09
138 0.08
139 0.06
140 0.07
141 0.08
142 0.08
143 0.07
144 0.1
145 0.1
146 0.17
147 0.24
148 0.27
149 0.33
150 0.42
151 0.51
152 0.54
153 0.62
154 0.59
155 0.55
156 0.55
157 0.49
158 0.48
159 0.41
160 0.38
161 0.28
162 0.25
163 0.23
164 0.19
165 0.2
166 0.14
167 0.12
168 0.11
169 0.11
170 0.1
171 0.09
172 0.1
173 0.08
174 0.08
175 0.1
176 0.1
177 0.1
178 0.1
179 0.1
180 0.1
181 0.1
182 0.08
183 0.06
184 0.06
185 0.09
186 0.15
187 0.16
188 0.17
189 0.21
190 0.28
191 0.31
192 0.38
193 0.4
194 0.42
195 0.42
196 0.43
197 0.43
198 0.43
199 0.43
200 0.44
201 0.42
202 0.39
203 0.45
204 0.49
205 0.49
206 0.48
207 0.53
208 0.48
209 0.52
210 0.51
211 0.47
212 0.47
213 0.44
214 0.41
215 0.42
216 0.46
217 0.48
218 0.49
219 0.51
220 0.52
221 0.58
222 0.63
223 0.62
224 0.62
225 0.64
226 0.67
227 0.62
228 0.62
229 0.61
230 0.56
231 0.5
232 0.49
233 0.46
234 0.46
235 0.55
236 0.59
237 0.62
238 0.69
239 0.75
240 0.79
241 0.82
242 0.81
243 0.75
244 0.73
245 0.69
246 0.62
247 0.55
248 0.47
249 0.44
250 0.4
251 0.41
252 0.35
253 0.39