Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KBG2

Protein Details
Accession Q5KBG2    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
159-190VVVKAGKRKREEPKRKKAAKKEEEPKPKKAKABasic
NLS Segment(s)
PositionSequence
10-28KPAPAKKPAPRPRAAAAKP
162-202KAGKRKREEPKRKKAAKKEEEPKPKKAKAVSKAVSKAGDKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035503  IOC4-like_PWWP  
IPR000313  PWWP_dom  
IPR035441  TFIIS/LEDGF_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0006338  P:chromatin remodeling  
KEGG cne:CNI02650  -  
Pfam View protein in Pfam  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS50812  PWWP  
CDD cd05840  PWWP_ScIOC4-like  
Amino Acid Sequences MSSSPARDDKPAPAKKPAPRPRAAAAKPPADHKFDIGDIVLARLRGYPPWPARIANPETLPRNVLKTRPGKNPNLYCCQFFPAGDFSWLQNKDIKALSASDISSFLAQPHRKSSGGLREAYQTAQDPTEWDAQQEEIHKQQEEAEANVDELEDEDEAEVVVKAGKRKREEPKRKKAAKKEEEPKPKKAKAVSKAVSKAGDKKAVSKTEVDEDPLASDPECVKVKDWRHKLQKAFLGESMPAEPEMSHWNEVFESIESYDSMTIEALQYSKIGKVMKKIMGLTTIPLNDKYDFTRRAGKLMHQWQEFIDAANRGRVTNGQKKSARPPSAPSAAATAAEEETPAKEDKPADETPAEEKKEESAEPVAEKKEESAEPVTEKKEESAELVTEGKMELDEKEKEAAAEEPAAAEKTEEVGAGAGEEAEAAEAPEPEAAEKPEANGEDKMQVDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.78
4 0.79
5 0.77
6 0.74
7 0.75
8 0.73
9 0.76
10 0.71
11 0.7
12 0.67
13 0.66
14 0.62
15 0.64
16 0.61
17 0.55
18 0.52
19 0.44
20 0.4
21 0.32
22 0.32
23 0.25
24 0.22
25 0.17
26 0.18
27 0.17
28 0.14
29 0.13
30 0.14
31 0.15
32 0.15
33 0.17
34 0.24
35 0.27
36 0.34
37 0.36
38 0.35
39 0.38
40 0.44
41 0.47
42 0.43
43 0.42
44 0.43
45 0.44
46 0.44
47 0.43
48 0.36
49 0.38
50 0.36
51 0.35
52 0.38
53 0.43
54 0.49
55 0.57
56 0.64
57 0.66
58 0.72
59 0.78
60 0.75
61 0.76
62 0.71
63 0.63
64 0.57
65 0.52
66 0.43
67 0.34
68 0.3
69 0.24
70 0.24
71 0.23
72 0.22
73 0.19
74 0.27
75 0.27
76 0.25
77 0.26
78 0.25
79 0.26
80 0.26
81 0.26
82 0.18
83 0.19
84 0.2
85 0.18
86 0.18
87 0.15
88 0.14
89 0.14
90 0.13
91 0.12
92 0.12
93 0.18
94 0.21
95 0.23
96 0.27
97 0.3
98 0.3
99 0.31
100 0.37
101 0.38
102 0.4
103 0.4
104 0.36
105 0.36
106 0.37
107 0.35
108 0.3
109 0.21
110 0.17
111 0.16
112 0.15
113 0.12
114 0.15
115 0.21
116 0.19
117 0.18
118 0.17
119 0.17
120 0.19
121 0.21
122 0.2
123 0.18
124 0.2
125 0.2
126 0.2
127 0.21
128 0.25
129 0.23
130 0.22
131 0.19
132 0.17
133 0.17
134 0.17
135 0.14
136 0.08
137 0.07
138 0.07
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.05
145 0.04
146 0.04
147 0.06
148 0.07
149 0.12
150 0.16
151 0.22
152 0.26
153 0.35
154 0.46
155 0.55
156 0.66
157 0.72
158 0.79
159 0.84
160 0.9
161 0.91
162 0.9
163 0.9
164 0.88
165 0.87
166 0.86
167 0.85
168 0.87
169 0.83
170 0.82
171 0.81
172 0.74
173 0.69
174 0.66
175 0.65
176 0.6
177 0.65
178 0.61
179 0.58
180 0.58
181 0.56
182 0.51
183 0.44
184 0.44
185 0.37
186 0.38
187 0.32
188 0.34
189 0.38
190 0.38
191 0.38
192 0.32
193 0.3
194 0.28
195 0.28
196 0.24
197 0.19
198 0.16
199 0.15
200 0.14
201 0.13
202 0.08
203 0.09
204 0.07
205 0.11
206 0.12
207 0.11
208 0.12
209 0.18
210 0.25
211 0.33
212 0.4
213 0.46
214 0.54
215 0.6
216 0.62
217 0.62
218 0.6
219 0.54
220 0.49
221 0.41
222 0.33
223 0.26
224 0.24
225 0.18
226 0.13
227 0.1
228 0.08
229 0.07
230 0.07
231 0.1
232 0.11
233 0.12
234 0.11
235 0.12
236 0.12
237 0.12
238 0.12
239 0.08
240 0.07
241 0.07
242 0.07
243 0.07
244 0.07
245 0.07
246 0.06
247 0.06
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.05
255 0.06
256 0.07
257 0.09
258 0.12
259 0.13
260 0.18
261 0.24
262 0.27
263 0.28
264 0.29
265 0.27
266 0.27
267 0.26
268 0.22
269 0.19
270 0.17
271 0.16
272 0.16
273 0.18
274 0.15
275 0.16
276 0.19
277 0.23
278 0.24
279 0.25
280 0.34
281 0.32
282 0.35
283 0.36
284 0.36
285 0.38
286 0.45
287 0.5
288 0.41
289 0.41
290 0.37
291 0.4
292 0.36
293 0.27
294 0.21
295 0.16
296 0.16
297 0.2
298 0.2
299 0.16
300 0.16
301 0.2
302 0.26
303 0.32
304 0.36
305 0.41
306 0.44
307 0.49
308 0.58
309 0.63
310 0.61
311 0.54
312 0.55
313 0.54
314 0.56
315 0.52
316 0.43
317 0.36
318 0.3
319 0.28
320 0.23
321 0.16
322 0.12
323 0.11
324 0.1
325 0.08
326 0.08
327 0.1
328 0.1
329 0.09
330 0.12
331 0.14
332 0.15
333 0.21
334 0.22
335 0.23
336 0.23
337 0.25
338 0.28
339 0.34
340 0.34
341 0.28
342 0.28
343 0.26
344 0.29
345 0.27
346 0.24
347 0.19
348 0.2
349 0.22
350 0.25
351 0.24
352 0.22
353 0.22
354 0.2
355 0.22
356 0.2
357 0.22
358 0.21
359 0.22
360 0.25
361 0.29
362 0.3
363 0.27
364 0.27
365 0.25
366 0.24
367 0.22
368 0.21
369 0.19
370 0.17
371 0.18
372 0.19
373 0.17
374 0.15
375 0.14
376 0.12
377 0.1
378 0.1
379 0.09
380 0.13
381 0.15
382 0.17
383 0.19
384 0.19
385 0.19
386 0.19
387 0.19
388 0.16
389 0.16
390 0.14
391 0.12
392 0.13
393 0.14
394 0.12
395 0.11
396 0.09
397 0.1
398 0.1
399 0.09
400 0.08
401 0.08
402 0.08
403 0.08
404 0.07
405 0.05
406 0.04
407 0.04
408 0.04
409 0.04
410 0.04
411 0.04
412 0.05
413 0.06
414 0.06
415 0.08
416 0.08
417 0.09
418 0.12
419 0.13
420 0.16
421 0.16
422 0.18
423 0.22
424 0.24
425 0.26
426 0.26
427 0.26
428 0.27