Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9X468

Protein Details
Accession A0A0F9X468    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-51APESVPPRRERRQMQRTQRRPQQQQQNGPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSSQSMEKERTDSAEDYGSDSAPESVPPRRERRQMQRTQRRPQQQQQNGPLDQLPVGGELGQVGQTAGGVLGGVTNTLGSVTNNAVDQKGGGDGGKSDTLRLRLDLNLDIEIQLKAKIHGDLELALL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.25
4 0.24
5 0.21
6 0.16
7 0.16
8 0.15
9 0.11
10 0.12
11 0.12
12 0.17
13 0.24
14 0.31
15 0.38
16 0.44
17 0.53
18 0.61
19 0.69
20 0.74
21 0.77
22 0.82
23 0.85
24 0.88
25 0.89
26 0.88
27 0.87
28 0.85
29 0.84
30 0.84
31 0.81
32 0.81
33 0.79
34 0.77
35 0.67
36 0.59
37 0.5
38 0.39
39 0.3
40 0.22
41 0.13
42 0.07
43 0.07
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.03
65 0.03
66 0.03
67 0.05
68 0.05
69 0.06
70 0.07
71 0.08
72 0.08
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.06
79 0.05
80 0.06
81 0.09
82 0.12
83 0.12
84 0.13
85 0.16
86 0.19
87 0.2
88 0.2
89 0.19
90 0.17
91 0.2
92 0.22
93 0.21
94 0.19
95 0.18
96 0.17
97 0.16
98 0.16
99 0.14
100 0.12
101 0.11
102 0.12
103 0.14
104 0.15
105 0.14
106 0.16
107 0.16