Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5K6V7

Protein Details
Accession Q5K6V7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
234-255MVEPRFLDRSRRRRARTGAAGGHydrophilic
NLS Segment(s)
PositionSequence
272-277RRRRAR
Subcellular Location(s) mito 11, plas 7, extr 4, cyto 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009567  SARAF  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006816  P:calcium ion transport  
GO:2001256  P:regulation of store-operated calcium entry  
KEGG cne:CNN02120  -  
Pfam View protein in Pfam  
PF06682  SARAF  
Amino Acid Sequences MKRNTAGAKKIALSAVKTLTFYADKYTAGRRTNPIPQLTCQGPGCKVFQPDVVQCTNMGDDGLGNVQWKCDTDIPSSLRLGKVDVSCEGWSAPGDPYILQGSCGLTYNLYKVNKGLEYGEDPYSTLPSHYDRVFNKAFNIIFYLVTFIILYNLFRTLSRRCMGWRLPGLWPGGGGGGGGWXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRRRLVGWMGTGTRVRRRSSSPSPSTSPLYQKPPARPTSYRSTTANSSTSSKHMVEPRFLDRSRRRRARTGAAGGMGEMRRATGFGGTSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.28
4 0.27
5 0.24
6 0.24
7 0.23
8 0.21
9 0.22
10 0.2
11 0.19
12 0.22
13 0.29
14 0.32
15 0.35
16 0.39
17 0.39
18 0.43
19 0.51
20 0.55
21 0.54
22 0.5
23 0.49
24 0.5
25 0.47
26 0.46
27 0.39
28 0.36
29 0.32
30 0.31
31 0.32
32 0.3
33 0.3
34 0.27
35 0.29
36 0.31
37 0.31
38 0.34
39 0.32
40 0.28
41 0.26
42 0.25
43 0.21
44 0.16
45 0.13
46 0.08
47 0.06
48 0.07
49 0.07
50 0.06
51 0.08
52 0.07
53 0.08
54 0.09
55 0.1
56 0.12
57 0.15
58 0.18
59 0.19
60 0.26
61 0.28
62 0.3
63 0.31
64 0.29
65 0.26
66 0.23
67 0.22
68 0.19
69 0.18
70 0.17
71 0.17
72 0.18
73 0.17
74 0.17
75 0.16
76 0.12
77 0.11
78 0.11
79 0.1
80 0.08
81 0.08
82 0.08
83 0.09
84 0.11
85 0.1
86 0.1
87 0.1
88 0.09
89 0.09
90 0.1
91 0.09
92 0.08
93 0.08
94 0.09
95 0.14
96 0.14
97 0.14
98 0.14
99 0.16
100 0.16
101 0.16
102 0.15
103 0.11
104 0.13
105 0.16
106 0.16
107 0.13
108 0.13
109 0.13
110 0.13
111 0.11
112 0.09
113 0.08
114 0.09
115 0.12
116 0.12
117 0.17
118 0.17
119 0.23
120 0.24
121 0.23
122 0.22
123 0.23
124 0.22
125 0.17
126 0.18
127 0.13
128 0.12
129 0.11
130 0.12
131 0.08
132 0.08
133 0.08
134 0.06
135 0.06
136 0.06
137 0.06
138 0.05
139 0.06
140 0.06
141 0.07
142 0.1
143 0.11
144 0.16
145 0.17
146 0.18
147 0.19
148 0.25
149 0.27
150 0.31
151 0.32
152 0.3
153 0.31
154 0.33
155 0.33
156 0.26
157 0.24
158 0.16
159 0.13
160 0.1
161 0.08
162 0.04
163 0.05
164 0.05
165 0.06
166 0.07
167 0.07
168 0.08
169 0.09
170 0.09
171 0.1
172 0.13
173 0.15
174 0.16
175 0.18
176 0.19
177 0.21
178 0.23
179 0.24
180 0.28
181 0.31
182 0.31
183 0.31
184 0.36
185 0.42
186 0.5
187 0.57
188 0.56
189 0.57
190 0.59
191 0.59
192 0.58
193 0.54
194 0.51
195 0.46
196 0.47
197 0.47
198 0.49
199 0.54
200 0.57
201 0.59
202 0.59
203 0.57
204 0.55
205 0.59
206 0.59
207 0.55
208 0.49
209 0.48
210 0.45
211 0.46
212 0.43
213 0.35
214 0.33
215 0.31
216 0.32
217 0.31
218 0.28
219 0.3
220 0.35
221 0.35
222 0.38
223 0.4
224 0.44
225 0.47
226 0.47
227 0.52
228 0.55
229 0.62
230 0.67
231 0.73
232 0.73
233 0.75
234 0.82
235 0.82
236 0.82
237 0.79
238 0.73
239 0.65
240 0.58
241 0.49
242 0.46
243 0.36
244 0.27
245 0.19
246 0.15
247 0.13
248 0.13
249 0.13
250 0.1
251 0.11