Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9X1N3

Protein Details
Accession A0A0F9X1N3    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
421-449LLPAAATRCTRRKRGPCRLARTVRPYVPCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_mito 10.666, cyto_nucl 9.833, mito 5.5, nucl 3, pero 3
Family & Domain DBs
Amino Acid Sequences MASSIMAEITRLDLKDLRAPLAASITDVKPLSSYNWIEAPTPTIAVPGCPPLWSPLRGSRRLQKDSGLVYIAQNAARHPESPLEPLFRAVYITNPTFDIRSIDVVTDRNNVRKLLSFIDPGSLQDGLQTFTIHIEVMQNTAIFCREEAATQEYIGPQEFRGFGHEFEKAYTSNQIDGSTGHHRVISYRFGDLNFIVRHETDGYVTDTTPNSQEPGDANLSNILASLSLSPSKGLADTTPTGSKLTIRKEGLVVPPESFLEIKTRASRRPLHIRDVAPQLWLSQTPKLVRAYHTKGTFQRPEIEDVAAEIKVWEKANKDNLGKLAALIRKIIGIVKEGGGSATVNVVLSGRPCSVGALQAPDDVPAPANVKHFSRELVYLDPVTVVIRDALLHLLHDKPVFHRPAGPCHHMNSFTLPAPKALLPAAATRCTRRKRGPCRLARTVRPYVPCRGSTWPYRDPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.3
4 0.29
5 0.27
6 0.28
7 0.26
8 0.26
9 0.23
10 0.18
11 0.21
12 0.19
13 0.22
14 0.22
15 0.2
16 0.18
17 0.19
18 0.2
19 0.23
20 0.24
21 0.22
22 0.26
23 0.27
24 0.27
25 0.27
26 0.28
27 0.21
28 0.2
29 0.17
30 0.16
31 0.15
32 0.15
33 0.16
34 0.17
35 0.16
36 0.16
37 0.16
38 0.2
39 0.24
40 0.25
41 0.28
42 0.34
43 0.42
44 0.47
45 0.53
46 0.57
47 0.62
48 0.66
49 0.63
50 0.57
51 0.55
52 0.52
53 0.49
54 0.41
55 0.32
56 0.27
57 0.28
58 0.25
59 0.21
60 0.18
61 0.16
62 0.2
63 0.2
64 0.2
65 0.18
66 0.21
67 0.21
68 0.25
69 0.28
70 0.28
71 0.27
72 0.28
73 0.27
74 0.23
75 0.22
76 0.17
77 0.18
78 0.19
79 0.2
80 0.19
81 0.19
82 0.2
83 0.19
84 0.19
85 0.19
86 0.14
87 0.16
88 0.16
89 0.15
90 0.16
91 0.17
92 0.18
93 0.22
94 0.23
95 0.25
96 0.27
97 0.27
98 0.27
99 0.29
100 0.29
101 0.27
102 0.28
103 0.25
104 0.23
105 0.25
106 0.24
107 0.2
108 0.2
109 0.16
110 0.12
111 0.12
112 0.12
113 0.11
114 0.11
115 0.11
116 0.09
117 0.09
118 0.1
119 0.07
120 0.07
121 0.08
122 0.08
123 0.09
124 0.09
125 0.09
126 0.09
127 0.09
128 0.1
129 0.08
130 0.07
131 0.08
132 0.08
133 0.08
134 0.11
135 0.14
136 0.13
137 0.13
138 0.14
139 0.13
140 0.14
141 0.14
142 0.12
143 0.08
144 0.1
145 0.1
146 0.09
147 0.14
148 0.14
149 0.15
150 0.16
151 0.18
152 0.17
153 0.17
154 0.19
155 0.14
156 0.14
157 0.17
158 0.16
159 0.16
160 0.16
161 0.16
162 0.14
163 0.14
164 0.17
165 0.18
166 0.18
167 0.16
168 0.16
169 0.16
170 0.18
171 0.2
172 0.21
173 0.17
174 0.18
175 0.18
176 0.18
177 0.19
178 0.18
179 0.2
180 0.16
181 0.15
182 0.14
183 0.13
184 0.14
185 0.14
186 0.14
187 0.09
188 0.1
189 0.11
190 0.11
191 0.11
192 0.12
193 0.11
194 0.11
195 0.12
196 0.1
197 0.09
198 0.09
199 0.1
200 0.09
201 0.12
202 0.14
203 0.13
204 0.13
205 0.12
206 0.12
207 0.11
208 0.1
209 0.07
210 0.04
211 0.04
212 0.04
213 0.05
214 0.05
215 0.05
216 0.05
217 0.06
218 0.06
219 0.06
220 0.06
221 0.05
222 0.08
223 0.09
224 0.11
225 0.12
226 0.12
227 0.13
228 0.12
229 0.16
230 0.17
231 0.2
232 0.24
233 0.24
234 0.25
235 0.25
236 0.28
237 0.28
238 0.27
239 0.24
240 0.18
241 0.18
242 0.17
243 0.17
244 0.14
245 0.1
246 0.11
247 0.11
248 0.13
249 0.19
250 0.22
251 0.24
252 0.3
253 0.36
254 0.39
255 0.49
256 0.51
257 0.51
258 0.55
259 0.53
260 0.52
261 0.52
262 0.45
263 0.35
264 0.31
265 0.25
266 0.19
267 0.2
268 0.17
269 0.13
270 0.16
271 0.16
272 0.2
273 0.23
274 0.24
275 0.25
276 0.32
277 0.36
278 0.39
279 0.4
280 0.41
281 0.43
282 0.49
283 0.5
284 0.44
285 0.45
286 0.4
287 0.42
288 0.39
289 0.34
290 0.26
291 0.22
292 0.22
293 0.14
294 0.12
295 0.08
296 0.07
297 0.1
298 0.11
299 0.12
300 0.13
301 0.18
302 0.26
303 0.32
304 0.33
305 0.33
306 0.33
307 0.33
308 0.31
309 0.27
310 0.26
311 0.21
312 0.21
313 0.18
314 0.17
315 0.15
316 0.15
317 0.16
318 0.11
319 0.11
320 0.11
321 0.11
322 0.12
323 0.11
324 0.11
325 0.1
326 0.09
327 0.07
328 0.06
329 0.06
330 0.05
331 0.05
332 0.06
333 0.06
334 0.07
335 0.09
336 0.09
337 0.09
338 0.09
339 0.11
340 0.11
341 0.14
342 0.14
343 0.16
344 0.16
345 0.17
346 0.17
347 0.16
348 0.16
349 0.13
350 0.12
351 0.1
352 0.13
353 0.13
354 0.17
355 0.18
356 0.19
357 0.22
358 0.22
359 0.22
360 0.22
361 0.22
362 0.21
363 0.22
364 0.23
365 0.21
366 0.2
367 0.19
368 0.16
369 0.14
370 0.11
371 0.09
372 0.06
373 0.06
374 0.06
375 0.07
376 0.09
377 0.08
378 0.09
379 0.11
380 0.12
381 0.14
382 0.16
383 0.16
384 0.18
385 0.26
386 0.29
387 0.28
388 0.34
389 0.35
390 0.43
391 0.5
392 0.53
393 0.47
394 0.48
395 0.52
396 0.46
397 0.44
398 0.41
399 0.37
400 0.34
401 0.37
402 0.34
403 0.29
404 0.31
405 0.3
406 0.26
407 0.22
408 0.2
409 0.16
410 0.22
411 0.25
412 0.28
413 0.3
414 0.35
415 0.44
416 0.5
417 0.57
418 0.61
419 0.68
420 0.74
421 0.83
422 0.86
423 0.88
424 0.9
425 0.92
426 0.9
427 0.89
428 0.87
429 0.85
430 0.81
431 0.78
432 0.73
433 0.72
434 0.69
435 0.62
436 0.57
437 0.56
438 0.55
439 0.56
440 0.6
441 0.59