Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9ZYG8

Protein Details
Accession A0A0F9ZYG8    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
317-343GSPGLAGKKKPPPPPPKKKPGLAAAAPHydrophilic
NLS Segment(s)
PositionSequence
14-39SGREKASEYKGKAKGKVTKHIPGRGH
321-338LAGKKKPPPPPPKKKPGL
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSKYAEMAKGKLSSGREKASEYKGKAKGKVTKHIPGRGHKEENDAATHVARPLASLRDPNSFAPPPKRTGSGLAPPPPPSAAKRSVVTAPSKYQDPHGPRVEPPPRFADEHQLEEYEAQQEAQPVSSGPYRVNTTGLSTDHLPPPPVRRDAAAAGSRSPPSYDSVVGATPSDAKAPSLPPRLPPRSGSGTPDQTASPLATLGVSSGSLNQGAVNRLGAAGISVPAFGIGAPSHADDEAPPPKPPRPNATPPSHLNELQNRFARLGTSNTGSSTGPPTPPTEAAAVAAVAPAAAPAATTWAQKQAAIRPAAPSPSPTGSPGLAGKKKPPPPPPKKKPGLAAAAPSPGDGGAPPPIPLSTRPSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.41
4 0.43
5 0.49
6 0.53
7 0.57
8 0.53
9 0.57
10 0.6
11 0.65
12 0.67
13 0.69
14 0.68
15 0.67
16 0.72
17 0.7
18 0.7
19 0.72
20 0.74
21 0.73
22 0.74
23 0.75
24 0.74
25 0.73
26 0.66
27 0.65
28 0.61
29 0.56
30 0.49
31 0.41
32 0.34
33 0.28
34 0.28
35 0.21
36 0.18
37 0.15
38 0.13
39 0.15
40 0.17
41 0.18
42 0.22
43 0.24
44 0.29
45 0.32
46 0.32
47 0.36
48 0.36
49 0.4
50 0.44
51 0.45
52 0.44
53 0.45
54 0.46
55 0.41
56 0.42
57 0.43
58 0.42
59 0.46
60 0.47
61 0.47
62 0.46
63 0.46
64 0.42
65 0.38
66 0.33
67 0.32
68 0.31
69 0.32
70 0.31
71 0.33
72 0.35
73 0.37
74 0.39
75 0.36
76 0.34
77 0.33
78 0.35
79 0.32
80 0.32
81 0.35
82 0.37
83 0.41
84 0.42
85 0.42
86 0.41
87 0.51
88 0.55
89 0.49
90 0.46
91 0.43
92 0.41
93 0.42
94 0.41
95 0.41
96 0.36
97 0.38
98 0.36
99 0.31
100 0.28
101 0.25
102 0.25
103 0.16
104 0.13
105 0.09
106 0.08
107 0.1
108 0.1
109 0.09
110 0.09
111 0.07
112 0.1
113 0.11
114 0.11
115 0.1
116 0.13
117 0.15
118 0.16
119 0.17
120 0.15
121 0.15
122 0.17
123 0.17
124 0.16
125 0.16
126 0.18
127 0.19
128 0.2
129 0.19
130 0.18
131 0.24
132 0.27
133 0.27
134 0.25
135 0.23
136 0.25
137 0.25
138 0.29
139 0.26
140 0.22
141 0.21
142 0.23
143 0.22
144 0.2
145 0.18
146 0.14
147 0.13
148 0.14
149 0.12
150 0.11
151 0.12
152 0.12
153 0.11
154 0.11
155 0.08
156 0.07
157 0.07
158 0.07
159 0.06
160 0.06
161 0.07
162 0.1
163 0.16
164 0.2
165 0.2
166 0.25
167 0.34
168 0.37
169 0.37
170 0.37
171 0.36
172 0.37
173 0.38
174 0.37
175 0.33
176 0.32
177 0.31
178 0.31
179 0.25
180 0.19
181 0.19
182 0.15
183 0.09
184 0.06
185 0.06
186 0.05
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.05
194 0.05
195 0.05
196 0.06
197 0.07
198 0.08
199 0.08
200 0.08
201 0.07
202 0.07
203 0.07
204 0.06
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.03
211 0.04
212 0.04
213 0.03
214 0.04
215 0.03
216 0.04
217 0.05
218 0.06
219 0.07
220 0.07
221 0.07
222 0.06
223 0.12
224 0.16
225 0.17
226 0.19
227 0.21
228 0.26
229 0.33
230 0.36
231 0.39
232 0.42
233 0.5
234 0.56
235 0.61
236 0.62
237 0.6
238 0.62
239 0.58
240 0.52
241 0.47
242 0.47
243 0.45
244 0.46
245 0.45
246 0.4
247 0.37
248 0.35
249 0.32
250 0.25
251 0.24
252 0.2
253 0.2
254 0.19
255 0.19
256 0.21
257 0.19
258 0.18
259 0.19
260 0.18
261 0.17
262 0.18
263 0.19
264 0.21
265 0.22
266 0.22
267 0.19
268 0.17
269 0.16
270 0.15
271 0.13
272 0.09
273 0.08
274 0.06
275 0.05
276 0.04
277 0.03
278 0.03
279 0.02
280 0.02
281 0.02
282 0.07
283 0.09
284 0.1
285 0.11
286 0.17
287 0.18
288 0.2
289 0.23
290 0.26
291 0.32
292 0.34
293 0.34
294 0.31
295 0.33
296 0.35
297 0.33
298 0.28
299 0.26
300 0.26
301 0.27
302 0.25
303 0.25
304 0.22
305 0.24
306 0.27
307 0.31
308 0.34
309 0.36
310 0.42
311 0.48
312 0.56
313 0.63
314 0.68
315 0.7
316 0.75
317 0.84
318 0.87
319 0.89
320 0.9
321 0.88
322 0.86
323 0.83
324 0.81
325 0.73
326 0.69
327 0.61
328 0.57
329 0.49
330 0.41
331 0.33
332 0.23
333 0.19
334 0.14
335 0.12
336 0.13
337 0.13
338 0.14
339 0.15
340 0.16
341 0.17
342 0.2