Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4GAJ6

Protein Details
Accession A0A0F4GAJ6    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-73SSSKSGPPSKSKKPSGPKPAPTQHKPKPTVDNRKKKPPHMKYTEKELKHydrophilic
150-177SLEDRKQNIKDDSKKRRRSDSEVAKPAKHydrophilic
NLS Segment(s)
PositionSequence
4-71KPKSGGPAKASNKRPGKPSSGGSSSKSGPPSKSKKPSGPKPAPTQHKPKPTVDNRKKKPPHMKYTEKE
81-93RPAGISKPPNAKK
142-192KRTQSKKESLEDRKQNIKDDSKKRRRSDSEVAKPAKEEVQGSKKAKLRKRV
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences MPPKPKSGGPAKASNKRPGKPSSGGSSSKSGPPSKSKKPSGPKPAPTQHKPKPTVDNRKKKPPHMKYTEKELKVPQLNGIRPAGISKPPNAKKGKNFVDDKESMNAILAMVMAEKEGNIESKMMRARQMEEVREARRIEAEKRTQSKKESLEDRKQNIKDDSKKRRRSDSEVAKPAKEEVQGSKKAKLRKRVSFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.7
4 0.71
5 0.67
6 0.65
7 0.61
8 0.6
9 0.58
10 0.56
11 0.55
12 0.51
13 0.49
14 0.44
15 0.43
16 0.43
17 0.39
18 0.37
19 0.43
20 0.48
21 0.54
22 0.62
23 0.65
24 0.69
25 0.76
26 0.81
27 0.83
28 0.84
29 0.81
30 0.81
31 0.83
32 0.83
33 0.8
34 0.8
35 0.77
36 0.77
37 0.74
38 0.7
39 0.71
40 0.72
41 0.77
42 0.77
43 0.8
44 0.77
45 0.83
46 0.84
47 0.83
48 0.84
49 0.83
50 0.83
51 0.81
52 0.84
53 0.76
54 0.81
55 0.8
56 0.7
57 0.63
58 0.55
59 0.53
60 0.47
61 0.44
62 0.39
63 0.36
64 0.35
65 0.35
66 0.33
67 0.25
68 0.21
69 0.22
70 0.18
71 0.16
72 0.16
73 0.18
74 0.27
75 0.3
76 0.38
77 0.41
78 0.44
79 0.46
80 0.54
81 0.57
82 0.54
83 0.53
84 0.47
85 0.49
86 0.46
87 0.42
88 0.34
89 0.27
90 0.2
91 0.17
92 0.16
93 0.09
94 0.07
95 0.05
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.05
105 0.05
106 0.06
107 0.06
108 0.1
109 0.13
110 0.14
111 0.17
112 0.18
113 0.2
114 0.28
115 0.32
116 0.31
117 0.34
118 0.38
119 0.36
120 0.39
121 0.37
122 0.29
123 0.29
124 0.3
125 0.28
126 0.32
127 0.38
128 0.42
129 0.49
130 0.55
131 0.55
132 0.57
133 0.6
134 0.57
135 0.57
136 0.58
137 0.61
138 0.65
139 0.69
140 0.71
141 0.73
142 0.7
143 0.68
144 0.65
145 0.66
146 0.66
147 0.67
148 0.73
149 0.74
150 0.82
151 0.81
152 0.85
153 0.82
154 0.81
155 0.82
156 0.81
157 0.81
158 0.81
159 0.79
160 0.7
161 0.63
162 0.56
163 0.49
164 0.4
165 0.33
166 0.32
167 0.36
168 0.45
169 0.47
170 0.52
171 0.54
172 0.6
173 0.65
174 0.67
175 0.68