Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P0CP02

Protein Details
Accession P0CP02    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
114-143SKEMEWPKSKDEPKKKDRPAKAQPSKAPSRBasic
527-552AVIEQHKKTKAKPRRAINPAYLKWKPHydrophilic
NLS Segment(s)
PositionSequence
121-199KSKDEPKKKDRPAKAQPSKAPSRATGSPIPSDSLLKKAANKAAMAAGKATPGKAMPSSKLGKASKIGKAGKFPQKRKAK
533-541KKTKAKPRR
Subcellular Location(s) nucl 16.5, cyto_nucl 13.333, mito_nucl 10.166, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR002717  HAT_MYST-type  
IPR025995  Tudor-knot  
IPR036388  WH-like_DNA-bd_sf  
IPR040706  Zf-MYST  
Gene Ontology GO:0035267  C:NuA4 histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0005721  C:pericentric heterochromatin  
GO:0035861  C:site of double-strand break  
GO:0044016  F:histone H3K4 acetyltransferase activity  
GO:0046872  F:metal ion binding  
GO:0106226  F:peptide 2-hydroxyisobutyryltransferase activity  
GO:0140065  F:peptide butyryltransferase activity  
GO:0140064  F:peptide crotonyltransferase activity  
GO:0034508  P:centromere complex assembly  
GO:0006302  P:double-strand break repair  
GO:0016573  P:histone acetylation  
GO:0031452  P:negative regulation of heterochromatin formation  
GO:1905168  P:positive regulation of double-strand break repair via homologous recombination  
GO:0031453  P:positive regulation of heterochromatin formation  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF01853  MOZ_SAS  
PF11717  Tudor-knot  
PF17772  zf-MYST  
PROSITE View protein in PROSITE  
PS51726  MYST_HAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MSPSAPSTPHGRGSGSEPGTPAPSVAAGGSYTIDDVVPGVKIYVIKPLSNGQAEQRRAEILSTRPKPKPSAFAPPPPPNAPSPDPRDDTEYYVHYVEFNKRLDEWVGGSRLVLSKEMEWPKSKDEPKKKDRPAKAQPSKAPSRATGSPIPSDSLLKKAANKAAMAAGKATPGKAMPSSKLGKASKIGKAGKFPQKRKAKTEADTEAEEESNEDNDALGEEEDMDEDGDVTLITSDGAIDPSREVVAAPSNPRAAPQVFSKKQEIEKLRTSGSMTQSHSEISRVKNLNKLQIGKHEVETWYFSPYPIEYAHLPVLYICEFCLLYYPSATQLRRHRAKCTLLHPPGNEIYRHEGISFFEIDGRKQRTWCRNLCLISKCFLDHKTLYYDVDPFLYYCMTVKDDYGCHLIGYFSKEKESAEGYNVACILTLPQHQRKGYGRLLIEFSYELSKVEGKLGSPEKPLSDLGLLGYRAYWQEKIVELLLDSDYEISLDEIAQKTSITHGDIMHTCQALQMIKYYKNSHIIHLTDAVIEQHKKTKAKPRRAINPAYLKWKPPVFSRAQLAFGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.36
4 0.31
5 0.31
6 0.32
7 0.3
8 0.25
9 0.16
10 0.14
11 0.12
12 0.11
13 0.1
14 0.08
15 0.08
16 0.09
17 0.08
18 0.08
19 0.08
20 0.07
21 0.06
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.08
28 0.1
29 0.1
30 0.19
31 0.2
32 0.2
33 0.22
34 0.27
35 0.31
36 0.32
37 0.33
38 0.33
39 0.4
40 0.42
41 0.41
42 0.38
43 0.34
44 0.32
45 0.33
46 0.29
47 0.28
48 0.36
49 0.42
50 0.49
51 0.52
52 0.56
53 0.61
54 0.61
55 0.62
56 0.57
57 0.6
58 0.59
59 0.64
60 0.69
61 0.7
62 0.71
63 0.66
64 0.63
65 0.54
66 0.54
67 0.49
68 0.48
69 0.47
70 0.48
71 0.49
72 0.48
73 0.52
74 0.46
75 0.45
76 0.4
77 0.35
78 0.31
79 0.28
80 0.26
81 0.21
82 0.23
83 0.26
84 0.28
85 0.27
86 0.26
87 0.26
88 0.28
89 0.28
90 0.26
91 0.23
92 0.22
93 0.22
94 0.2
95 0.2
96 0.19
97 0.2
98 0.2
99 0.18
100 0.14
101 0.14
102 0.23
103 0.28
104 0.3
105 0.32
106 0.34
107 0.38
108 0.46
109 0.52
110 0.54
111 0.6
112 0.67
113 0.73
114 0.81
115 0.85
116 0.87
117 0.88
118 0.88
119 0.88
120 0.89
121 0.88
122 0.87
123 0.83
124 0.81
125 0.8
126 0.74
127 0.66
128 0.57
129 0.53
130 0.47
131 0.46
132 0.43
133 0.38
134 0.36
135 0.34
136 0.33
137 0.28
138 0.28
139 0.24
140 0.22
141 0.23
142 0.21
143 0.24
144 0.28
145 0.31
146 0.3
147 0.29
148 0.27
149 0.28
150 0.27
151 0.24
152 0.2
153 0.16
154 0.17
155 0.17
156 0.16
157 0.11
158 0.1
159 0.12
160 0.14
161 0.16
162 0.15
163 0.21
164 0.25
165 0.26
166 0.34
167 0.33
168 0.32
169 0.35
170 0.39
171 0.37
172 0.42
173 0.46
174 0.39
175 0.44
176 0.51
177 0.55
178 0.59
179 0.59
180 0.61
181 0.66
182 0.7
183 0.7
184 0.71
185 0.68
186 0.64
187 0.67
188 0.62
189 0.55
190 0.5
191 0.45
192 0.36
193 0.29
194 0.24
195 0.17
196 0.12
197 0.09
198 0.08
199 0.07
200 0.05
201 0.05
202 0.06
203 0.05
204 0.05
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.04
224 0.04
225 0.05
226 0.05
227 0.05
228 0.06
229 0.05
230 0.05
231 0.05
232 0.08
233 0.1
234 0.12
235 0.13
236 0.15
237 0.15
238 0.15
239 0.17
240 0.15
241 0.15
242 0.2
243 0.28
244 0.3
245 0.33
246 0.35
247 0.36
248 0.38
249 0.44
250 0.42
251 0.37
252 0.4
253 0.39
254 0.36
255 0.34
256 0.33
257 0.3
258 0.29
259 0.28
260 0.24
261 0.23
262 0.23
263 0.22
264 0.21
265 0.18
266 0.18
267 0.14
268 0.21
269 0.23
270 0.23
271 0.3
272 0.31
273 0.35
274 0.36
275 0.37
276 0.3
277 0.34
278 0.37
279 0.32
280 0.31
281 0.27
282 0.24
283 0.22
284 0.24
285 0.18
286 0.17
287 0.15
288 0.14
289 0.13
290 0.12
291 0.13
292 0.11
293 0.12
294 0.09
295 0.12
296 0.13
297 0.12
298 0.12
299 0.1
300 0.11
301 0.09
302 0.09
303 0.06
304 0.06
305 0.06
306 0.06
307 0.09
308 0.09
309 0.08
310 0.09
311 0.09
312 0.12
313 0.18
314 0.18
315 0.22
316 0.29
317 0.39
318 0.47
319 0.49
320 0.5
321 0.52
322 0.58
323 0.57
324 0.54
325 0.55
326 0.53
327 0.55
328 0.5
329 0.47
330 0.44
331 0.4
332 0.36
333 0.27
334 0.27
335 0.25
336 0.25
337 0.21
338 0.18
339 0.17
340 0.18
341 0.17
342 0.1
343 0.13
344 0.13
345 0.14
346 0.21
347 0.25
348 0.24
349 0.27
350 0.35
351 0.41
352 0.49
353 0.53
354 0.52
355 0.53
356 0.55
357 0.59
358 0.57
359 0.49
360 0.44
361 0.39
362 0.35
363 0.31
364 0.29
365 0.27
366 0.22
367 0.23
368 0.24
369 0.24
370 0.25
371 0.23
372 0.23
373 0.18
374 0.18
375 0.15
376 0.11
377 0.11
378 0.09
379 0.08
380 0.08
381 0.09
382 0.1
383 0.1
384 0.1
385 0.12
386 0.13
387 0.15
388 0.17
389 0.16
390 0.13
391 0.13
392 0.13
393 0.12
394 0.18
395 0.19
396 0.17
397 0.18
398 0.19
399 0.19
400 0.21
401 0.22
402 0.18
403 0.17
404 0.21
405 0.2
406 0.21
407 0.2
408 0.18
409 0.14
410 0.13
411 0.11
412 0.09
413 0.15
414 0.21
415 0.27
416 0.34
417 0.34
418 0.4
419 0.44
420 0.49
421 0.48
422 0.47
423 0.42
424 0.39
425 0.42
426 0.36
427 0.32
428 0.25
429 0.21
430 0.17
431 0.16
432 0.13
433 0.12
434 0.13
435 0.12
436 0.15
437 0.15
438 0.13
439 0.2
440 0.24
441 0.25
442 0.27
443 0.28
444 0.26
445 0.28
446 0.28
447 0.22
448 0.19
449 0.16
450 0.14
451 0.17
452 0.16
453 0.13
454 0.13
455 0.12
456 0.14
457 0.16
458 0.15
459 0.12
460 0.15
461 0.16
462 0.18
463 0.18
464 0.16
465 0.14
466 0.15
467 0.14
468 0.12
469 0.11
470 0.09
471 0.08
472 0.07
473 0.07
474 0.06
475 0.06
476 0.06
477 0.1
478 0.1
479 0.11
480 0.11
481 0.11
482 0.11
483 0.14
484 0.16
485 0.14
486 0.15
487 0.15
488 0.2
489 0.22
490 0.25
491 0.26
492 0.24
493 0.22
494 0.21
495 0.23
496 0.2
497 0.19
498 0.22
499 0.23
500 0.28
501 0.34
502 0.37
503 0.39
504 0.47
505 0.47
506 0.46
507 0.48
508 0.45
509 0.42
510 0.41
511 0.36
512 0.27
513 0.27
514 0.24
515 0.22
516 0.23
517 0.23
518 0.27
519 0.34
520 0.37
521 0.44
522 0.53
523 0.58
524 0.67
525 0.74
526 0.77
527 0.81
528 0.86
529 0.86
530 0.85
531 0.85
532 0.8
533 0.8
534 0.74
535 0.67
536 0.65
537 0.62
538 0.55
539 0.51
540 0.53
541 0.5
542 0.53
543 0.58
544 0.54