Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GKQ4

Protein Details
Accession A0A0F4GKQ4    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
167-194KKVFVIVRPTTKKKKRKRTAQNGIIGIPHydrophilic
NLS Segment(s)
PositionSequence
177-184TKKKKRKR
Subcellular Location(s) nucl 15, cyto 10
Family & Domain DBs
Amino Acid Sequences MSSEASSASVEAMIKSMYVSDKTEVFEVCTFGECVATFDLAERFGLSDLKEAARRASGPAGERPRLGADVGESMKLVPNVRSAGVSALVDNSLLKRMPEFVAEEDNDTLQRLEGRDKIRWLDMLERRSTVDSTAISPGEDSVFKDSPNHSCVTKAARAMVDLESNLKKVFVIVRPTTKKKKRKRTAQNGIIGIPSTSSPADGSPFLDASASV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.1
5 0.12
6 0.14
7 0.15
8 0.17
9 0.19
10 0.21
11 0.19
12 0.2
13 0.19
14 0.18
15 0.17
16 0.16
17 0.15
18 0.13
19 0.14
20 0.11
21 0.12
22 0.11
23 0.11
24 0.09
25 0.1
26 0.11
27 0.1
28 0.1
29 0.08
30 0.08
31 0.08
32 0.1
33 0.09
34 0.11
35 0.12
36 0.14
37 0.17
38 0.17
39 0.17
40 0.18
41 0.18
42 0.18
43 0.19
44 0.2
45 0.2
46 0.27
47 0.33
48 0.32
49 0.32
50 0.31
51 0.29
52 0.27
53 0.24
54 0.16
55 0.11
56 0.14
57 0.14
58 0.13
59 0.11
60 0.11
61 0.12
62 0.13
63 0.13
64 0.09
65 0.11
66 0.12
67 0.12
68 0.12
69 0.11
70 0.11
71 0.11
72 0.1
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.06
81 0.06
82 0.06
83 0.08
84 0.08
85 0.09
86 0.1
87 0.1
88 0.13
89 0.13
90 0.14
91 0.13
92 0.12
93 0.11
94 0.1
95 0.09
96 0.06
97 0.07
98 0.06
99 0.09
100 0.14
101 0.17
102 0.19
103 0.2
104 0.22
105 0.22
106 0.22
107 0.21
108 0.25
109 0.27
110 0.29
111 0.28
112 0.28
113 0.28
114 0.28
115 0.27
116 0.19
117 0.15
118 0.12
119 0.12
120 0.14
121 0.13
122 0.11
123 0.11
124 0.11
125 0.1
126 0.1
127 0.09
128 0.12
129 0.13
130 0.13
131 0.16
132 0.18
133 0.2
134 0.22
135 0.23
136 0.18
137 0.18
138 0.21
139 0.24
140 0.25
141 0.23
142 0.23
143 0.22
144 0.22
145 0.23
146 0.22
147 0.17
148 0.14
149 0.18
150 0.16
151 0.16
152 0.16
153 0.14
154 0.12
155 0.13
156 0.17
157 0.18
158 0.25
159 0.29
160 0.39
161 0.47
162 0.56
163 0.65
164 0.71
165 0.76
166 0.79
167 0.86
168 0.87
169 0.89
170 0.92
171 0.93
172 0.94
173 0.93
174 0.91
175 0.83
176 0.73
177 0.63
178 0.52
179 0.41
180 0.3
181 0.21
182 0.14
183 0.11
184 0.1
185 0.1
186 0.1
187 0.13
188 0.13
189 0.14
190 0.15
191 0.15
192 0.14