Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4G5Y6

Protein Details
Accession A0A0F4G5Y6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MPPTTKSTNRPPVPKNPPTKKPAPKPPVKSPSGPHydrophilic
NLS Segment(s)
PositionSequence
12-37PVPKNPPTKKPAPKPPVKSPSGPTKP
Subcellular Location(s) mito 15.5, mito_nucl 9.333, cyto 8.5, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MPPTTKSTNRPPVPKNPPTKKPAPKPPVKSPSGPTKPIPAGVRSNPTKNTTAKPAEPAPTGNWINRTVQNSVAGVGNYAGSLITGVGNSVNKVGMGVGERISDTTRGWGQGVAGYGNDIKDSVGVGGPRVATGGNPLGLAGQGSSKNMPLPASKTKSAAEKNKAANNRKTSAVNPLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.8
4 0.81
5 0.8
6 0.84
7 0.83
8 0.83
9 0.85
10 0.84
11 0.85
12 0.84
13 0.87
14 0.86
15 0.8
16 0.75
17 0.69
18 0.7
19 0.67
20 0.63
21 0.54
22 0.52
23 0.49
24 0.5
25 0.47
26 0.4
27 0.39
28 0.39
29 0.45
30 0.42
31 0.45
32 0.43
33 0.45
34 0.45
35 0.42
36 0.42
37 0.41
38 0.42
39 0.39
40 0.39
41 0.39
42 0.38
43 0.35
44 0.34
45 0.27
46 0.29
47 0.29
48 0.26
49 0.25
50 0.23
51 0.25
52 0.27
53 0.28
54 0.23
55 0.22
56 0.23
57 0.2
58 0.19
59 0.17
60 0.13
61 0.1
62 0.09
63 0.07
64 0.05
65 0.05
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.04
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.06
84 0.06
85 0.06
86 0.06
87 0.07
88 0.08
89 0.08
90 0.07
91 0.09
92 0.1
93 0.1
94 0.1
95 0.1
96 0.1
97 0.1
98 0.11
99 0.08
100 0.07
101 0.08
102 0.08
103 0.08
104 0.07
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.07
113 0.08
114 0.08
115 0.08
116 0.08
117 0.07
118 0.06
119 0.09
120 0.1
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.06
128 0.07
129 0.07
130 0.09
131 0.1
132 0.11
133 0.13
134 0.14
135 0.15
136 0.16
137 0.21
138 0.29
139 0.34
140 0.36
141 0.37
142 0.39
143 0.46
144 0.52
145 0.55
146 0.53
147 0.55
148 0.6
149 0.66
150 0.72
151 0.72
152 0.73
153 0.7
154 0.66
155 0.62
156 0.59
157 0.53
158 0.54