Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GXW7

Protein Details
Accession A0A0F4GXW7   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
230-249EKVSHKKGPGKKPGKKLGNNBasic
NLS Segment(s)
PositionSequence
173-191KERERARAEAANRRLDRAR
229-246AEKVSHKKGPGKKPGKKL
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003903  UIM_dom  
PROSITE View protein in PROSITE  
PS50330  UIM  
Amino Acid Sequences MARYHDAPTRHAAAKVENNRQEYSLYLPLHPKTSRKGSVSKHDDKAKKERDLAASRGSVDPTTGRRRGTMRSKEHDDEEEQLKRAIEESKRAADGGTGTGRRVGKRGRDDSSEDKHESKRQRTASISVPSVTRTADLEDDTDGEGNPTTSKIKKAKAEAAQSARQVKQAEQEKERERARAEAANRRLDRARSRRNDEAELDDDGAEVAPSHHDSPPPPSSQPPSPPAPAEKVSHKKGPGKKPGKKLGNNQYTKRNLEQAASSPFGRKRGLQTQATTGSGDEGQDSANADTNGNGTNKTSPSGAENGNTNGIGNGTGRKFGRPKKNVVNGNGNGRTTINAGEEVEKTFTNMSLALNNMSVYIAKQQGELGLPAVASGVSPGSGGEESLSAGGAVQPPGGGEGEGVHKVEVEPKFEELSSVEMAVKLQENIAKWQAEYGHLVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.57
4 0.57
5 0.59
6 0.57
7 0.56
8 0.49
9 0.41
10 0.37
11 0.35
12 0.3
13 0.3
14 0.34
15 0.35
16 0.41
17 0.43
18 0.42
19 0.42
20 0.49
21 0.53
22 0.53
23 0.59
24 0.6
25 0.68
26 0.73
27 0.74
28 0.73
29 0.75
30 0.76
31 0.74
32 0.78
33 0.76
34 0.73
35 0.7
36 0.69
37 0.69
38 0.69
39 0.66
40 0.61
41 0.54
42 0.49
43 0.44
44 0.39
45 0.29
46 0.24
47 0.24
48 0.25
49 0.32
50 0.34
51 0.33
52 0.36
53 0.39
54 0.47
55 0.53
56 0.56
57 0.57
58 0.62
59 0.69
60 0.68
61 0.69
62 0.64
63 0.56
64 0.51
65 0.48
66 0.44
67 0.37
68 0.35
69 0.31
70 0.27
71 0.26
72 0.28
73 0.24
74 0.27
75 0.31
76 0.33
77 0.33
78 0.33
79 0.31
80 0.25
81 0.24
82 0.2
83 0.21
84 0.18
85 0.18
86 0.23
87 0.26
88 0.25
89 0.29
90 0.31
91 0.34
92 0.43
93 0.49
94 0.48
95 0.5
96 0.56
97 0.58
98 0.6
99 0.57
100 0.51
101 0.49
102 0.49
103 0.52
104 0.55
105 0.54
106 0.55
107 0.53
108 0.56
109 0.55
110 0.55
111 0.55
112 0.51
113 0.46
114 0.38
115 0.35
116 0.3
117 0.27
118 0.24
119 0.16
120 0.12
121 0.12
122 0.12
123 0.12
124 0.11
125 0.11
126 0.11
127 0.11
128 0.1
129 0.09
130 0.08
131 0.07
132 0.07
133 0.07
134 0.07
135 0.1
136 0.11
137 0.19
138 0.24
139 0.29
140 0.34
141 0.39
142 0.46
143 0.5
144 0.54
145 0.54
146 0.54
147 0.52
148 0.51
149 0.5
150 0.43
151 0.4
152 0.35
153 0.29
154 0.31
155 0.36
156 0.38
157 0.37
158 0.43
159 0.44
160 0.5
161 0.5
162 0.46
163 0.38
164 0.35
165 0.35
166 0.32
167 0.33
168 0.35
169 0.39
170 0.45
171 0.44
172 0.44
173 0.43
174 0.42
175 0.47
176 0.48
177 0.53
178 0.51
179 0.58
180 0.62
181 0.63
182 0.62
183 0.54
184 0.48
185 0.4
186 0.34
187 0.27
188 0.21
189 0.17
190 0.13
191 0.11
192 0.07
193 0.05
194 0.04
195 0.04
196 0.05
197 0.07
198 0.08
199 0.09
200 0.1
201 0.16
202 0.19
203 0.21
204 0.21
205 0.21
206 0.25
207 0.27
208 0.31
209 0.29
210 0.29
211 0.28
212 0.28
213 0.28
214 0.28
215 0.27
216 0.25
217 0.29
218 0.32
219 0.35
220 0.38
221 0.4
222 0.44
223 0.5
224 0.57
225 0.6
226 0.64
227 0.68
228 0.73
229 0.79
230 0.81
231 0.79
232 0.79
233 0.79
234 0.78
235 0.77
236 0.71
237 0.7
238 0.66
239 0.62
240 0.54
241 0.49
242 0.39
243 0.34
244 0.32
245 0.27
246 0.26
247 0.25
248 0.23
249 0.23
250 0.23
251 0.25
252 0.25
253 0.23
254 0.25
255 0.32
256 0.38
257 0.37
258 0.38
259 0.4
260 0.41
261 0.4
262 0.34
263 0.25
264 0.2
265 0.16
266 0.14
267 0.09
268 0.07
269 0.06
270 0.07
271 0.08
272 0.07
273 0.09
274 0.1
275 0.09
276 0.09
277 0.1
278 0.13
279 0.12
280 0.12
281 0.1
282 0.13
283 0.14
284 0.15
285 0.14
286 0.12
287 0.14
288 0.18
289 0.18
290 0.16
291 0.18
292 0.18
293 0.19
294 0.18
295 0.15
296 0.11
297 0.1
298 0.1
299 0.08
300 0.11
301 0.11
302 0.15
303 0.16
304 0.21
305 0.28
306 0.36
307 0.46
308 0.47
309 0.55
310 0.62
311 0.7
312 0.72
313 0.71
314 0.72
315 0.65
316 0.69
317 0.64
318 0.53
319 0.45
320 0.38
321 0.33
322 0.24
323 0.22
324 0.14
325 0.12
326 0.13
327 0.14
328 0.15
329 0.15
330 0.16
331 0.14
332 0.14
333 0.13
334 0.12
335 0.11
336 0.11
337 0.1
338 0.1
339 0.12
340 0.12
341 0.12
342 0.11
343 0.11
344 0.1
345 0.09
346 0.08
347 0.12
348 0.14
349 0.14
350 0.15
351 0.15
352 0.17
353 0.18
354 0.17
355 0.13
356 0.1
357 0.1
358 0.09
359 0.09
360 0.07
361 0.05
362 0.05
363 0.05
364 0.04
365 0.04
366 0.04
367 0.07
368 0.07
369 0.07
370 0.07
371 0.07
372 0.08
373 0.08
374 0.08
375 0.05
376 0.05
377 0.07
378 0.09
379 0.09
380 0.08
381 0.08
382 0.08
383 0.1
384 0.1
385 0.08
386 0.06
387 0.08
388 0.11
389 0.13
390 0.14
391 0.12
392 0.12
393 0.13
394 0.2
395 0.21
396 0.21
397 0.22
398 0.23
399 0.25
400 0.25
401 0.26
402 0.19
403 0.21
404 0.18
405 0.17
406 0.15
407 0.14
408 0.14
409 0.15
410 0.16
411 0.13
412 0.14
413 0.16
414 0.17
415 0.23
416 0.28
417 0.27
418 0.25
419 0.28
420 0.27
421 0.27