Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4GP96

Protein Details
Accession A0A0F4GP96    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
2-25APTTPKTRRSTRVQEAPARKKKKEHydrophilic
NLS Segment(s)
PositionSequence
13-70RVQEAPARKKKKEEEEALKLAGLPPKTKGTKSIKSKTMSSSKPTVTKVVKSKPTPKPK
Subcellular Location(s) nucl 12.5, mito_nucl 11.833, mito 10, cyto_mito 7.833
Family & Domain DBs
Amino Acid Sequences MAPTTPKTRRSTRVQEAPARKKKKEEEEALKLAGLPPKTKGTKSIKSKTMSSSKPTVTKVVKSKPTPKPKTKFVGYPATRKEMFPYLYPPLEPDYEPKWQPRWGTWPTAPKAGPKACTFDKYYFFSFLGDAPRAQRALESLCKTLEESGFGGDVEKANKPLFDARDVLREWTEWRDSIPPDEYSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.83
4 0.86
5 0.87
6 0.85
7 0.78
8 0.76
9 0.77
10 0.78
11 0.77
12 0.76
13 0.76
14 0.76
15 0.76
16 0.68
17 0.59
18 0.48
19 0.41
20 0.35
21 0.27
22 0.19
23 0.19
24 0.26
25 0.29
26 0.29
27 0.36
28 0.4
29 0.48
30 0.57
31 0.62
32 0.62
33 0.63
34 0.65
35 0.63
36 0.63
37 0.58
38 0.53
39 0.51
40 0.47
41 0.49
42 0.47
43 0.47
44 0.41
45 0.44
46 0.47
47 0.49
48 0.53
49 0.54
50 0.62
51 0.65
52 0.73
53 0.75
54 0.78
55 0.76
56 0.76
57 0.77
58 0.71
59 0.66
60 0.6
61 0.62
62 0.55
63 0.56
64 0.51
65 0.49
66 0.45
67 0.4
68 0.37
69 0.31
70 0.29
71 0.23
72 0.24
73 0.22
74 0.22
75 0.21
76 0.2
77 0.17
78 0.17
79 0.16
80 0.15
81 0.15
82 0.19
83 0.2
84 0.22
85 0.23
86 0.25
87 0.25
88 0.25
89 0.29
90 0.28
91 0.32
92 0.33
93 0.39
94 0.37
95 0.42
96 0.4
97 0.35
98 0.4
99 0.37
100 0.36
101 0.29
102 0.33
103 0.3
104 0.33
105 0.34
106 0.31
107 0.32
108 0.32
109 0.33
110 0.3
111 0.28
112 0.25
113 0.22
114 0.2
115 0.2
116 0.17
117 0.16
118 0.15
119 0.17
120 0.17
121 0.16
122 0.15
123 0.13
124 0.16
125 0.23
126 0.24
127 0.23
128 0.24
129 0.24
130 0.25
131 0.25
132 0.21
133 0.16
134 0.13
135 0.13
136 0.13
137 0.12
138 0.12
139 0.1
140 0.12
141 0.12
142 0.13
143 0.15
144 0.15
145 0.15
146 0.17
147 0.23
148 0.23
149 0.25
150 0.27
151 0.26
152 0.32
153 0.33
154 0.33
155 0.28
156 0.27
157 0.26
158 0.28
159 0.29
160 0.23
161 0.25
162 0.28
163 0.29
164 0.33
165 0.34