Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GVQ9

Protein Details
Accession A0A0F4GVQ9   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
68-89LKKSDRLLKKPLKQRLPPQFLQHydrophilic
206-226AYKEYRFKKLQRRELRVKAAEHydrophilic
NLS Segment(s)
PositionSequence
217-218RR
221-221R
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MSRHALSLPFRTLAPSTRSLASQWTCRRCLATQADASSGAPTETVPANYDPTLPFSQRIGPDGQHYSLKKSDRLLKKPLKQRLPPQFLQHSTSEILHESERAMRDDTVRHKKIVGVVVNSGKMDKTVTVRINGQKWNTRIRKMFPDHIQHLVHDPNNSLVTGDVVELHRLKVSRKVEHVVASIVSPFGTPIESRPPIPTADERLAAYKEYRFKKLQRRELRVKAAEGKAEAIRALKNRGLNPGAGVEDGVGQLENAEDGDGQTKTPSEGAILGEKGQKLPEGVLPGGMREVGKIDDWSTEKKAEYRRLRAEESRNLSEAKEKEAELNQQDLETRNTSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.3
4 0.31
5 0.32
6 0.3
7 0.36
8 0.35
9 0.39
10 0.44
11 0.48
12 0.49
13 0.5
14 0.53
15 0.46
16 0.51
17 0.49
18 0.47
19 0.45
20 0.44
21 0.44
22 0.4
23 0.39
24 0.31
25 0.24
26 0.16
27 0.11
28 0.09
29 0.1
30 0.11
31 0.11
32 0.13
33 0.14
34 0.17
35 0.17
36 0.19
37 0.17
38 0.21
39 0.24
40 0.23
41 0.23
42 0.22
43 0.28
44 0.27
45 0.29
46 0.26
47 0.24
48 0.28
49 0.3
50 0.3
51 0.31
52 0.31
53 0.33
54 0.36
55 0.38
56 0.36
57 0.38
58 0.45
59 0.49
60 0.54
61 0.6
62 0.64
63 0.69
64 0.76
65 0.8
66 0.8
67 0.78
68 0.81
69 0.82
70 0.8
71 0.75
72 0.73
73 0.71
74 0.64
75 0.6
76 0.51
77 0.43
78 0.36
79 0.33
80 0.26
81 0.19
82 0.18
83 0.14
84 0.14
85 0.12
86 0.14
87 0.15
88 0.16
89 0.16
90 0.16
91 0.17
92 0.23
93 0.31
94 0.38
95 0.39
96 0.38
97 0.37
98 0.37
99 0.4
100 0.41
101 0.35
102 0.27
103 0.29
104 0.3
105 0.3
106 0.28
107 0.24
108 0.17
109 0.14
110 0.12
111 0.1
112 0.11
113 0.16
114 0.18
115 0.2
116 0.25
117 0.29
118 0.33
119 0.35
120 0.36
121 0.36
122 0.37
123 0.46
124 0.45
125 0.47
126 0.46
127 0.46
128 0.52
129 0.51
130 0.55
131 0.52
132 0.55
133 0.51
134 0.52
135 0.49
136 0.4
137 0.37
138 0.33
139 0.28
140 0.21
141 0.19
142 0.15
143 0.15
144 0.14
145 0.11
146 0.08
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.07
153 0.08
154 0.08
155 0.09
156 0.09
157 0.1
158 0.16
159 0.21
160 0.22
161 0.25
162 0.27
163 0.28
164 0.29
165 0.29
166 0.22
167 0.18
168 0.14
169 0.12
170 0.09
171 0.08
172 0.05
173 0.05
174 0.04
175 0.05
176 0.04
177 0.06
178 0.13
179 0.14
180 0.15
181 0.17
182 0.18
183 0.18
184 0.21
185 0.21
186 0.2
187 0.21
188 0.21
189 0.2
190 0.21
191 0.21
192 0.19
193 0.18
194 0.17
195 0.22
196 0.25
197 0.29
198 0.32
199 0.39
200 0.49
201 0.58
202 0.65
203 0.67
204 0.74
205 0.78
206 0.82
207 0.83
208 0.75
209 0.68
210 0.65
211 0.57
212 0.5
213 0.4
214 0.35
215 0.26
216 0.24
217 0.21
218 0.14
219 0.15
220 0.16
221 0.19
222 0.19
223 0.23
224 0.24
225 0.29
226 0.29
227 0.26
228 0.25
229 0.23
230 0.21
231 0.17
232 0.15
233 0.09
234 0.09
235 0.08
236 0.07
237 0.05
238 0.04
239 0.04
240 0.04
241 0.04
242 0.03
243 0.04
244 0.03
245 0.04
246 0.07
247 0.07
248 0.08
249 0.08
250 0.09
251 0.09
252 0.1
253 0.09
254 0.08
255 0.09
256 0.11
257 0.13
258 0.14
259 0.15
260 0.18
261 0.19
262 0.18
263 0.18
264 0.17
265 0.14
266 0.15
267 0.16
268 0.17
269 0.16
270 0.19
271 0.18
272 0.18
273 0.18
274 0.17
275 0.14
276 0.1
277 0.12
278 0.1
279 0.11
280 0.12
281 0.12
282 0.16
283 0.19
284 0.23
285 0.25
286 0.27
287 0.28
288 0.33
289 0.4
290 0.46
291 0.53
292 0.58
293 0.64
294 0.67
295 0.72
296 0.75
297 0.75
298 0.74
299 0.73
300 0.68
301 0.6
302 0.55
303 0.49
304 0.48
305 0.41
306 0.37
307 0.32
308 0.28
309 0.31
310 0.35
311 0.42
312 0.37
313 0.4
314 0.34
315 0.32
316 0.33
317 0.31
318 0.31