Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KAA1

Protein Details
Accession Q5KAA1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
29-48AERAFRKKSLKYHPDKNPAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11.833, cyto 9.5, mito_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000390  P:spliceosomal complex disassembly  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MPPILSEEESALDPYVVLGIGAGATTKEAERAFRKKSLKYHPDKNPAPEAAVIFHQLSLSLGIFQDQAKRNYVDNQLEIDRKKKQRYAEMDKKRKAMVDALVAREEEAKKQKVEQVKRWQQQVQADEEAIKDAGRRMLEEAQKRAAAIAAAATAARAARAPEAAARKPTGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.06
4 0.05
5 0.04
6 0.03
7 0.03
8 0.03
9 0.04
10 0.03
11 0.04
12 0.05
13 0.05
14 0.08
15 0.09
16 0.15
17 0.22
18 0.29
19 0.33
20 0.41
21 0.47
22 0.5
23 0.58
24 0.64
25 0.67
26 0.69
27 0.74
28 0.76
29 0.81
30 0.79
31 0.75
32 0.7
33 0.61
34 0.54
35 0.45
36 0.36
37 0.27
38 0.23
39 0.2
40 0.13
41 0.13
42 0.11
43 0.09
44 0.09
45 0.08
46 0.07
47 0.06
48 0.05
49 0.06
50 0.07
51 0.07
52 0.14
53 0.17
54 0.18
55 0.21
56 0.22
57 0.23
58 0.27
59 0.32
60 0.28
61 0.25
62 0.25
63 0.25
64 0.27
65 0.27
66 0.26
67 0.29
68 0.32
69 0.36
70 0.37
71 0.39
72 0.44
73 0.52
74 0.59
75 0.61
76 0.67
77 0.72
78 0.72
79 0.7
80 0.62
81 0.54
82 0.45
83 0.38
84 0.29
85 0.27
86 0.26
87 0.25
88 0.25
89 0.24
90 0.23
91 0.22
92 0.2
93 0.17
94 0.21
95 0.22
96 0.22
97 0.24
98 0.28
99 0.34
100 0.42
101 0.46
102 0.51
103 0.59
104 0.64
105 0.68
106 0.66
107 0.62
108 0.61
109 0.54
110 0.48
111 0.39
112 0.35
113 0.3
114 0.27
115 0.23
116 0.17
117 0.13
118 0.09
119 0.09
120 0.12
121 0.12
122 0.12
123 0.15
124 0.22
125 0.29
126 0.34
127 0.36
128 0.37
129 0.37
130 0.36
131 0.33
132 0.26
133 0.2
134 0.14
135 0.11
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.06
143 0.06
144 0.07
145 0.08
146 0.09
147 0.11
148 0.16
149 0.23
150 0.27
151 0.31
152 0.32