Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KBL1

Protein Details
Accession Q5KBL1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-42LWKNPWRLSPTRKANQRKRLKRVDDVIHydrophilic
99-120FSKRDPGYRKSQHKVPKWTRLTHydrophilic
NLS Segment(s)
PositionSequence
32-33RK
Subcellular Location(s) mito 24.5, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG cne:CNI02170  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTSFVSGGLLWKNPWRLSPTRKANQRKRLKRVDDVISMVAESGVTTRSLVKALALPTEAEMSPRGKLKCLRLRLARCMQVVYGQRREYKYTTFSKRDPGYRKSQHKVPKWTRLTLRENPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.22
5 0.27
6 0.26
7 0.28
8 0.3
9 0.36
10 0.43
11 0.52
12 0.57
13 0.61
14 0.7
15 0.78
16 0.82
17 0.85
18 0.88
19 0.88
20 0.87
21 0.89
22 0.85
23 0.82
24 0.79
25 0.75
26 0.67
27 0.59
28 0.5
29 0.39
30 0.32
31 0.24
32 0.17
33 0.1
34 0.07
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.06
41 0.06
42 0.06
43 0.07
44 0.09
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.1
51 0.1
52 0.08
53 0.09
54 0.09
55 0.1
56 0.14
57 0.14
58 0.16
59 0.2
60 0.29
61 0.36
62 0.4
63 0.46
64 0.5
65 0.55
66 0.6
67 0.63
68 0.58
69 0.51
70 0.46
71 0.39
72 0.37
73 0.39
74 0.37
75 0.37
76 0.35
77 0.39
78 0.4
79 0.44
80 0.41
81 0.38
82 0.39
83 0.41
84 0.47
85 0.48
86 0.48
87 0.53
88 0.56
89 0.61
90 0.61
91 0.59
92 0.61
93 0.65
94 0.72
95 0.7
96 0.73
97 0.74
98 0.76
99 0.81
100 0.8
101 0.81
102 0.77
103 0.79
104 0.79
105 0.78
106 0.77
107 0.76
108 0.77