Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KL91

Protein Details
Accession Q5KL91    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRLRRSRTHHARRDVHRAARTBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0003676  F:nucleic acid binding  
GO:0043023  F:ribosomal large subunit binding  
GO:0008270  F:zinc ion binding  
GO:0000055  P:ribosomal large subunit export from nucleus  
KEGG cne:CNC00330  -  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MGRLRRSRTHHARRDVHRAARTRARVKDLDQIETDLRPQNRNRLEKQPIDEDKPGLGQHYCVECSKYCETAVALQSHLKSKVHKRRLKELKEGAYTVDESERAAGLGTDNKQRGVEDVIKRFDGINSSAAGPSIVAQPQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.81
4 0.77
5 0.74
6 0.71
7 0.71
8 0.72
9 0.7
10 0.67
11 0.65
12 0.6
13 0.57
14 0.58
15 0.52
16 0.47
17 0.39
18 0.37
19 0.32
20 0.29
21 0.28
22 0.26
23 0.25
24 0.27
25 0.28
26 0.35
27 0.42
28 0.48
29 0.5
30 0.53
31 0.59
32 0.58
33 0.6
34 0.6
35 0.55
36 0.54
37 0.51
38 0.42
39 0.35
40 0.32
41 0.28
42 0.2
43 0.16
44 0.11
45 0.12
46 0.13
47 0.14
48 0.13
49 0.15
50 0.14
51 0.19
52 0.2
53 0.18
54 0.16
55 0.15
56 0.15
57 0.17
58 0.19
59 0.14
60 0.13
61 0.14
62 0.15
63 0.17
64 0.18
65 0.15
66 0.18
67 0.27
68 0.37
69 0.46
70 0.5
71 0.53
72 0.62
73 0.72
74 0.73
75 0.72
76 0.7
77 0.66
78 0.65
79 0.6
80 0.5
81 0.41
82 0.35
83 0.26
84 0.2
85 0.13
86 0.1
87 0.1
88 0.09
89 0.07
90 0.07
91 0.06
92 0.06
93 0.11
94 0.13
95 0.19
96 0.2
97 0.21
98 0.22
99 0.22
100 0.23
101 0.24
102 0.3
103 0.31
104 0.37
105 0.39
106 0.39
107 0.4
108 0.38
109 0.33
110 0.29
111 0.23
112 0.18
113 0.16
114 0.17
115 0.17
116 0.17
117 0.15
118 0.12
119 0.11
120 0.13