Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4GME4

Protein Details
Accession A0A0F4GME4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-108HLSSLPHRYKIRHRRKPRHLPRPFBasic
NLS Segment(s)
PositionSequence
93-107YKIRHRRKPRHLPRP
Subcellular Location(s) mito 13, nucl 9, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029052  Metallo-depent_PP-like  
Amino Acid Sequences MPNPYEIPSIRRQLYNPTRLLARLISYLFSLLHSSHKPNLNITVICISDTHTLIPTFIPLGDILIHAGDLTNAGTPAELQAQIDHLSSLPHRYKIRHRRKPRHLPRPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.5
4 0.45
5 0.43
6 0.41
7 0.42
8 0.33
9 0.25
10 0.2
11 0.18
12 0.16
13 0.15
14 0.15
15 0.13
16 0.12
17 0.11
18 0.09
19 0.13
20 0.15
21 0.18
22 0.22
23 0.28
24 0.28
25 0.28
26 0.31
27 0.3
28 0.28
29 0.26
30 0.23
31 0.17
32 0.17
33 0.15
34 0.14
35 0.13
36 0.13
37 0.12
38 0.1
39 0.1
40 0.1
41 0.1
42 0.08
43 0.06
44 0.06
45 0.06
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.07
65 0.07
66 0.07
67 0.07
68 0.09
69 0.1
70 0.1
71 0.09
72 0.08
73 0.09
74 0.1
75 0.18
76 0.2
77 0.25
78 0.29
79 0.34
80 0.45
81 0.55
82 0.66
83 0.69
84 0.77
85 0.82
86 0.9
87 0.96
88 0.96