Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GL26

Protein Details
Accession A0A0F4GL26    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-58IPNLDSPKYQKTKKRKRETDGEDKDAHydrophilic
NLS Segment(s)
PositionSequence
45-48KKRK
145-157AGGGKKKKNKGKK
Subcellular Location(s) nucl 22.5, mito_nucl 12.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPVLSSSEEWQRQSSLLLQARPTTTRITTKYNIPNLDSPKYQKTKKRKRETDGEDKDAQAAPRVPRATLTLKTYDPESGVVLKFKTDRAAEVGRLIGSVGRVGRYMAALPEKEEAQDIVPEDVPAIVQAADSTLPTSDSKPQSGAGGGKKKKNKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.31
4 0.31
5 0.32
6 0.34
7 0.36
8 0.36
9 0.34
10 0.29
11 0.27
12 0.32
13 0.33
14 0.37
15 0.37
16 0.44
17 0.51
18 0.53
19 0.52
20 0.48
21 0.51
22 0.49
23 0.51
24 0.46
25 0.42
26 0.44
27 0.49
28 0.53
29 0.55
30 0.61
31 0.68
32 0.76
33 0.82
34 0.83
35 0.83
36 0.87
37 0.86
38 0.86
39 0.82
40 0.77
41 0.68
42 0.58
43 0.52
44 0.43
45 0.35
46 0.26
47 0.22
48 0.17
49 0.21
50 0.22
51 0.2
52 0.19
53 0.23
54 0.24
55 0.23
56 0.24
57 0.22
58 0.22
59 0.22
60 0.22
61 0.19
62 0.15
63 0.13
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.1
70 0.1
71 0.1
72 0.12
73 0.11
74 0.11
75 0.15
76 0.17
77 0.16
78 0.17
79 0.17
80 0.13
81 0.13
82 0.12
83 0.08
84 0.06
85 0.07
86 0.07
87 0.06
88 0.07
89 0.07
90 0.07
91 0.07
92 0.08
93 0.08
94 0.11
95 0.11
96 0.12
97 0.14
98 0.14
99 0.13
100 0.13
101 0.12
102 0.1
103 0.11
104 0.11
105 0.11
106 0.11
107 0.11
108 0.1
109 0.1
110 0.09
111 0.07
112 0.07
113 0.05
114 0.04
115 0.04
116 0.05
117 0.05
118 0.06
119 0.06
120 0.06
121 0.08
122 0.09
123 0.12
124 0.19
125 0.22
126 0.24
127 0.25
128 0.26
129 0.26
130 0.28
131 0.31
132 0.32
133 0.39
134 0.44
135 0.51
136 0.59
137 0.67