Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4GKG3

Protein Details
Accession A0A0F4GKG3    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
133-153VPKTPAPKKRVARKTVIKAEDHydrophilic
NLS Segment(s)
PositionSequence
80-87SSAKKRKA
107-114KKHGRGKK
140-142KKR
Subcellular Location(s) cyto_nucl 12.333, cyto 12, nucl 10.5, mito_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MSYNYQIAKDAISQPEKDRAFCIFLNTTNGVTNWEKATADFKSASVDSMKVSWRNTLKKIEKAGGKLDGDASTAPATPKSSAKKRKAEKEDSANNGEDVAPTTPAAKKHGRGKKAAASIVDKSDDGEYVEAGVPKTPAPKKRVARKTVIKAEDMDDVEGADDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.42
4 0.39
5 0.36
6 0.31
7 0.32
8 0.3
9 0.32
10 0.25
11 0.26
12 0.3
13 0.29
14 0.27
15 0.25
16 0.24
17 0.23
18 0.22
19 0.22
20 0.18
21 0.18
22 0.17
23 0.16
24 0.21
25 0.17
26 0.18
27 0.17
28 0.15
29 0.18
30 0.18
31 0.18
32 0.15
33 0.15
34 0.12
35 0.14
36 0.17
37 0.16
38 0.17
39 0.22
40 0.27
41 0.32
42 0.35
43 0.43
44 0.45
45 0.48
46 0.51
47 0.51
48 0.48
49 0.45
50 0.44
51 0.39
52 0.33
53 0.28
54 0.25
55 0.2
56 0.17
57 0.14
58 0.12
59 0.08
60 0.08
61 0.08
62 0.07
63 0.08
64 0.09
65 0.13
66 0.19
67 0.27
68 0.37
69 0.45
70 0.53
71 0.59
72 0.68
73 0.72
74 0.74
75 0.71
76 0.71
77 0.7
78 0.65
79 0.61
80 0.51
81 0.43
82 0.35
83 0.29
84 0.19
85 0.14
86 0.1
87 0.07
88 0.07
89 0.09
90 0.1
91 0.12
92 0.17
93 0.19
94 0.24
95 0.33
96 0.41
97 0.44
98 0.46
99 0.5
100 0.53
101 0.54
102 0.52
103 0.45
104 0.41
105 0.39
106 0.37
107 0.33
108 0.25
109 0.21
110 0.19
111 0.16
112 0.13
113 0.11
114 0.09
115 0.09
116 0.11
117 0.11
118 0.1
119 0.11
120 0.11
121 0.11
122 0.2
123 0.25
124 0.3
125 0.35
126 0.44
127 0.53
128 0.63
129 0.73
130 0.72
131 0.75
132 0.79
133 0.84
134 0.84
135 0.78
136 0.69
137 0.61
138 0.56
139 0.52
140 0.43
141 0.34
142 0.24
143 0.2