Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4G6S4

Protein Details
Accession A0A0F4G6S4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
235-269ESEPMRIKEKTKRRQRHVKKVKSKHRYTMIKIKELBasic
NLS Segment(s)
PositionSequence
240-260RIKEKTKRRQRHVKKVKSKHR
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
Amino Acid Sequences MLSRTLRRTLLDARYSLPPTYLLPWTAGLTTATQPPQSSEPPPELPSSSIPARTNSTGSESATAKSQDAEHLELPAPHSQSPGQTSSPPQLSESVRQLLPLLRSQGPHYMTVHIHGNPYLITEGDTVRLPFLMQGVEPGDVIRLNRAINLGSRDYALKAPAASPKMKSPTVATVSIVDPTTGTLATHSRVMPTSALAATEGTVHAPHFVPHLAKGKFSYVDDRMFVCRAVVTGVESEPMRIKEKTKRRQRHVKKVKSKHRYTMIKIKELRVKSVEEIESGEVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.42
4 0.35
5 0.27
6 0.25
7 0.27
8 0.26
9 0.2
10 0.19
11 0.2
12 0.2
13 0.19
14 0.18
15 0.15
16 0.14
17 0.15
18 0.19
19 0.19
20 0.19
21 0.19
22 0.22
23 0.25
24 0.27
25 0.28
26 0.28
27 0.31
28 0.34
29 0.35
30 0.35
31 0.32
32 0.3
33 0.29
34 0.3
35 0.27
36 0.29
37 0.28
38 0.29
39 0.32
40 0.31
41 0.3
42 0.26
43 0.29
44 0.26
45 0.25
46 0.26
47 0.22
48 0.21
49 0.23
50 0.23
51 0.17
52 0.16
53 0.16
54 0.16
55 0.18
56 0.2
57 0.17
58 0.18
59 0.19
60 0.18
61 0.2
62 0.2
63 0.19
64 0.16
65 0.18
66 0.16
67 0.18
68 0.21
69 0.22
70 0.2
71 0.2
72 0.22
73 0.26
74 0.28
75 0.26
76 0.23
77 0.24
78 0.25
79 0.28
80 0.29
81 0.27
82 0.24
83 0.24
84 0.24
85 0.22
86 0.22
87 0.2
88 0.2
89 0.19
90 0.2
91 0.21
92 0.26
93 0.25
94 0.25
95 0.23
96 0.22
97 0.2
98 0.22
99 0.23
100 0.18
101 0.17
102 0.15
103 0.14
104 0.11
105 0.12
106 0.1
107 0.07
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.06
117 0.06
118 0.06
119 0.05
120 0.04
121 0.05
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.08
135 0.09
136 0.12
137 0.12
138 0.11
139 0.11
140 0.11
141 0.12
142 0.12
143 0.11
144 0.09
145 0.08
146 0.09
147 0.13
148 0.16
149 0.16
150 0.17
151 0.21
152 0.25
153 0.25
154 0.24
155 0.22
156 0.26
157 0.28
158 0.27
159 0.23
160 0.21
161 0.21
162 0.21
163 0.19
164 0.12
165 0.09
166 0.08
167 0.08
168 0.07
169 0.06
170 0.06
171 0.07
172 0.08
173 0.11
174 0.11
175 0.11
176 0.12
177 0.13
178 0.12
179 0.11
180 0.12
181 0.1
182 0.1
183 0.09
184 0.08
185 0.07
186 0.08
187 0.07
188 0.06
189 0.06
190 0.06
191 0.07
192 0.08
193 0.08
194 0.09
195 0.11
196 0.11
197 0.15
198 0.24
199 0.23
200 0.24
201 0.25
202 0.27
203 0.28
204 0.28
205 0.3
206 0.25
207 0.28
208 0.28
209 0.28
210 0.27
211 0.26
212 0.24
213 0.18
214 0.14
215 0.12
216 0.12
217 0.1
218 0.09
219 0.09
220 0.1
221 0.12
222 0.11
223 0.13
224 0.16
225 0.18
226 0.2
227 0.21
228 0.26
229 0.34
230 0.45
231 0.54
232 0.61
233 0.7
234 0.76
235 0.86
236 0.92
237 0.93
238 0.94
239 0.94
240 0.94
241 0.95
242 0.95
243 0.95
244 0.92
245 0.9
246 0.9
247 0.88
248 0.85
249 0.84
250 0.81
251 0.8
252 0.76
253 0.74
254 0.72
255 0.65
256 0.63
257 0.56
258 0.52
259 0.46
260 0.49
261 0.42
262 0.35
263 0.35