Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5K8A5

Protein Details
Accession Q5K8A5    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
124-145QIKVAHRRKVLRHHPDKKASQTBasic
258-288SRDDKRFTEKKNKSERTRRKKEDNTRLRELVBasic
NLS Segment(s)
PositionSequence
266-278EKKNKSERTRRKK
297-377RIKRIKAEEKAAREAKKKGGAVGAPKQLSAAEKKKLEEQKKKEEEEKKVAEKKANEASKADREAAKKAKEAARKNLKKWKK
Subcellular Location(s) nucl 13, mito 12.5, cyto_mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR036869  J_dom_sf  
IPR032003  RAC_head  
IPR042569  RAC_head_sf  
IPR044634  Zuotin/DnaJC2  
Gene Ontology GO:0005829  C:cytosol  
GO:0015934  C:large ribosomal subunit  
GO:0005730  C:nucleolus  
GO:0042788  C:polysomal ribosome  
GO:0015935  C:small ribosomal subunit  
GO:0030544  F:Hsp70 protein binding  
GO:0043022  F:ribosome binding  
GO:0051083  P:'de novo' cotranslational protein folding  
GO:0071409  P:cellular response to cycloheximide  
GO:0060548  P:negative regulation of cell death  
GO:0036003  P:positive regulation of transcription from RNA polymerase II promoter in response to stress  
GO:0006450  P:regulation of translational fidelity  
GO:0000054  P:ribosomal subunit export from nucleus  
GO:0006364  P:rRNA processing  
GO:0006452  P:translational frameshifting  
KEGG cne:CNL06390  -  
Pfam View protein in Pfam  
PF00226  DnaJ  
PF16717  RAC_head  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MASVVTLPITLTATPAGYSKPSPSKASAPKQLPIYPAGPSFISAARRQILQRSFADDDKAILEAREREAEEKANASGDGTQYPGLGEEEESQTVLSSDPKEWKKQDHYAILGLGHLRYTATDDQIKVAHRRKVLRHHPDKKASQTGHGTNDDSFFKCIQKAHETLTNPERRRQFDSIDWNINDEVPDFKKLSPEEFCAQANALFAREGRFSKVQPVPEFGDLNSSKKDVEGFYDFFYNFDSWRSFEWHDKEVNEGSDSRDDKRFTEKKNKSERTRRKKEDNTRLRELVDSVLALDPRIKRIKAEEKAAREAKKKGGAVGAPKQLSAAEKKKLEEQKKKEEEEKKVAEKKANEASKADREAAKKAKEAARKNLKKWKKAISTVVASSNYFQAEGTAASAQVIEKQLGELDALVELLEPEQVKDLKEKIEKAGNGAPAKAALQEKVAALGEKGAGKFTEFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.14
5 0.16
6 0.23
7 0.3
8 0.34
9 0.38
10 0.41
11 0.49
12 0.56
13 0.64
14 0.66
15 0.62
16 0.63
17 0.65
18 0.64
19 0.57
20 0.51
21 0.43
22 0.37
23 0.34
24 0.3
25 0.24
26 0.22
27 0.21
28 0.21
29 0.23
30 0.22
31 0.26
32 0.26
33 0.29
34 0.3
35 0.36
36 0.37
37 0.39
38 0.39
39 0.41
40 0.42
41 0.4
42 0.42
43 0.34
44 0.3
45 0.25
46 0.24
47 0.17
48 0.14
49 0.16
50 0.15
51 0.18
52 0.2
53 0.21
54 0.22
55 0.24
56 0.27
57 0.25
58 0.24
59 0.22
60 0.19
61 0.18
62 0.17
63 0.16
64 0.14
65 0.13
66 0.13
67 0.12
68 0.11
69 0.11
70 0.11
71 0.1
72 0.09
73 0.09
74 0.11
75 0.13
76 0.13
77 0.13
78 0.12
79 0.12
80 0.11
81 0.11
82 0.11
83 0.11
84 0.14
85 0.22
86 0.26
87 0.34
88 0.37
89 0.45
90 0.49
91 0.55
92 0.6
93 0.57
94 0.56
95 0.51
96 0.49
97 0.4
98 0.34
99 0.27
100 0.19
101 0.13
102 0.1
103 0.08
104 0.07
105 0.11
106 0.12
107 0.15
108 0.18
109 0.18
110 0.2
111 0.23
112 0.26
113 0.29
114 0.34
115 0.36
116 0.38
117 0.45
118 0.5
119 0.58
120 0.65
121 0.68
122 0.72
123 0.77
124 0.81
125 0.83
126 0.83
127 0.79
128 0.77
129 0.67
130 0.62
131 0.59
132 0.54
133 0.5
134 0.46
135 0.4
136 0.32
137 0.33
138 0.29
139 0.24
140 0.22
141 0.18
142 0.17
143 0.18
144 0.19
145 0.21
146 0.24
147 0.24
148 0.26
149 0.3
150 0.3
151 0.34
152 0.41
153 0.45
154 0.41
155 0.46
156 0.48
157 0.46
158 0.51
159 0.49
160 0.44
161 0.42
162 0.49
163 0.49
164 0.5
165 0.45
166 0.4
167 0.37
168 0.34
169 0.27
170 0.19
171 0.16
172 0.11
173 0.13
174 0.13
175 0.13
176 0.17
177 0.18
178 0.21
179 0.21
180 0.23
181 0.23
182 0.23
183 0.23
184 0.19
185 0.19
186 0.16
187 0.14
188 0.1
189 0.09
190 0.07
191 0.07
192 0.08
193 0.1
194 0.1
195 0.13
196 0.15
197 0.15
198 0.22
199 0.26
200 0.29
201 0.27
202 0.3
203 0.29
204 0.29
205 0.29
206 0.21
207 0.26
208 0.22
209 0.23
210 0.2
211 0.18
212 0.16
213 0.15
214 0.17
215 0.09
216 0.12
217 0.13
218 0.14
219 0.14
220 0.16
221 0.16
222 0.15
223 0.16
224 0.13
225 0.1
226 0.1
227 0.1
228 0.09
229 0.11
230 0.15
231 0.15
232 0.2
233 0.23
234 0.25
235 0.26
236 0.25
237 0.27
238 0.24
239 0.23
240 0.19
241 0.16
242 0.15
243 0.18
244 0.19
245 0.19
246 0.22
247 0.22
248 0.23
249 0.32
250 0.37
251 0.37
252 0.47
253 0.52
254 0.57
255 0.68
256 0.75
257 0.75
258 0.8
259 0.85
260 0.85
261 0.89
262 0.88
263 0.87
264 0.88
265 0.89
266 0.89
267 0.89
268 0.85
269 0.81
270 0.74
271 0.64
272 0.55
273 0.45
274 0.34
275 0.24
276 0.16
277 0.11
278 0.1
279 0.1
280 0.09
281 0.12
282 0.11
283 0.16
284 0.21
285 0.2
286 0.2
287 0.28
288 0.38
289 0.39
290 0.47
291 0.48
292 0.49
293 0.57
294 0.62
295 0.6
296 0.54
297 0.53
298 0.5
299 0.5
300 0.46
301 0.39
302 0.38
303 0.35
304 0.37
305 0.41
306 0.41
307 0.35
308 0.34
309 0.32
310 0.29
311 0.29
312 0.3
313 0.28
314 0.28
315 0.31
316 0.32
317 0.4
318 0.49
319 0.57
320 0.59
321 0.62
322 0.66
323 0.72
324 0.75
325 0.76
326 0.76
327 0.73
328 0.72
329 0.72
330 0.7
331 0.69
332 0.69
333 0.66
334 0.59
335 0.58
336 0.58
337 0.55
338 0.47
339 0.42
340 0.44
341 0.45
342 0.45
343 0.42
344 0.37
345 0.35
346 0.41
347 0.46
348 0.44
349 0.4
350 0.44
351 0.48
352 0.52
353 0.57
354 0.6
355 0.63
356 0.68
357 0.73
358 0.77
359 0.79
360 0.79
361 0.79
362 0.79
363 0.77
364 0.76
365 0.76
366 0.73
367 0.7
368 0.64
369 0.62
370 0.53
371 0.44
372 0.38
373 0.32
374 0.25
375 0.19
376 0.16
377 0.11
378 0.1
379 0.1
380 0.11
381 0.09
382 0.08
383 0.08
384 0.09
385 0.08
386 0.11
387 0.12
388 0.11
389 0.11
390 0.11
391 0.12
392 0.12
393 0.12
394 0.08
395 0.07
396 0.07
397 0.06
398 0.06
399 0.05
400 0.05
401 0.05
402 0.07
403 0.07
404 0.07
405 0.12
406 0.13
407 0.15
408 0.19
409 0.22
410 0.28
411 0.34
412 0.37
413 0.38
414 0.45
415 0.45
416 0.46
417 0.49
418 0.48
419 0.44
420 0.41
421 0.36
422 0.29
423 0.29
424 0.27
425 0.24
426 0.17
427 0.18
428 0.19
429 0.19
430 0.21
431 0.21
432 0.17
433 0.15
434 0.16
435 0.17
436 0.19
437 0.19
438 0.18
439 0.17