Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4G692

Protein Details
Accession A0A0F4G692   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
78-101TYNQKFDPERRLHRQRRIAERTRAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, E.R. 4, mito 1, extr 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004648  Oligpept_transpt  
IPR004813  OPT  
Gene Ontology GO:0016020  C:membrane  
GO:0035673  F:oligopeptide transmembrane transporter activity  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF03169  OPT  
Amino Acid Sequences MKASVFYPSVLNGPILLVLDRRFGTLSKQQLTWYWVFSYVGLSSQPAYYSNHWNAQNFPWMAQQLFNTTSSTPTKFTTYNQKFDPERRLHRQRRIAERTRAAGVDSDILDLSQHYQCRVHRWYRTLSFWKRQESCEDRVARVQENPDIDPHYKLMVRNGYKEVPSWWWAAVLITVWVAGIACLYAMKSTLPWWAFLLSTIILWIMSLFFNSISGLTGFGFNLTPISQKLAGYLFPLHPLANLYFTTSASHGCSQAGLLAKDLRIAQYAHLPPRHTFWLQISGRLIGSLMDFRTNSTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.11
5 0.11
6 0.15
7 0.15
8 0.16
9 0.16
10 0.16
11 0.22
12 0.27
13 0.34
14 0.34
15 0.35
16 0.35
17 0.38
18 0.43
19 0.38
20 0.33
21 0.26
22 0.25
23 0.24
24 0.22
25 0.21
26 0.16
27 0.15
28 0.13
29 0.12
30 0.12
31 0.12
32 0.12
33 0.11
34 0.15
35 0.17
36 0.25
37 0.29
38 0.35
39 0.37
40 0.38
41 0.39
42 0.38
43 0.43
44 0.35
45 0.32
46 0.29
47 0.28
48 0.27
49 0.25
50 0.23
51 0.19
52 0.2
53 0.2
54 0.17
55 0.16
56 0.2
57 0.21
58 0.23
59 0.21
60 0.21
61 0.23
62 0.23
63 0.26
64 0.33
65 0.36
66 0.39
67 0.4
68 0.45
69 0.44
70 0.48
71 0.55
72 0.52
73 0.54
74 0.59
75 0.68
76 0.7
77 0.77
78 0.81
79 0.79
80 0.82
81 0.83
82 0.82
83 0.79
84 0.75
85 0.68
86 0.61
87 0.53
88 0.42
89 0.33
90 0.25
91 0.19
92 0.14
93 0.12
94 0.09
95 0.09
96 0.08
97 0.07
98 0.09
99 0.1
100 0.1
101 0.1
102 0.14
103 0.15
104 0.22
105 0.28
106 0.32
107 0.35
108 0.38
109 0.44
110 0.45
111 0.51
112 0.54
113 0.54
114 0.56
115 0.57
116 0.61
117 0.56
118 0.53
119 0.55
120 0.5
121 0.48
122 0.47
123 0.43
124 0.36
125 0.38
126 0.38
127 0.31
128 0.27
129 0.24
130 0.2
131 0.19
132 0.19
133 0.17
134 0.18
135 0.17
136 0.16
137 0.15
138 0.14
139 0.14
140 0.14
141 0.17
142 0.21
143 0.22
144 0.24
145 0.26
146 0.26
147 0.25
148 0.25
149 0.23
150 0.18
151 0.19
152 0.17
153 0.14
154 0.13
155 0.12
156 0.12
157 0.1
158 0.07
159 0.05
160 0.04
161 0.04
162 0.04
163 0.03
164 0.03
165 0.03
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.03
172 0.03
173 0.03
174 0.04
175 0.05
176 0.11
177 0.11
178 0.12
179 0.13
180 0.13
181 0.13
182 0.13
183 0.14
184 0.09
185 0.08
186 0.07
187 0.06
188 0.05
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.05
198 0.05
199 0.06
200 0.06
201 0.06
202 0.06
203 0.07
204 0.07
205 0.07
206 0.07
207 0.06
208 0.07
209 0.07
210 0.08
211 0.08
212 0.12
213 0.13
214 0.12
215 0.14
216 0.14
217 0.14
218 0.15
219 0.18
220 0.14
221 0.15
222 0.17
223 0.15
224 0.14
225 0.16
226 0.15
227 0.14
228 0.14
229 0.14
230 0.14
231 0.15
232 0.16
233 0.14
234 0.15
235 0.16
236 0.18
237 0.16
238 0.15
239 0.15
240 0.13
241 0.16
242 0.18
243 0.15
244 0.16
245 0.17
246 0.17
247 0.2
248 0.2
249 0.18
250 0.16
251 0.16
252 0.16
253 0.22
254 0.28
255 0.33
256 0.37
257 0.39
258 0.38
259 0.42
260 0.47
261 0.39
262 0.36
263 0.33
264 0.4
265 0.38
266 0.41
267 0.38
268 0.34
269 0.33
270 0.3
271 0.25
272 0.15
273 0.17
274 0.15
275 0.14
276 0.16
277 0.16