Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5K823

Protein Details
Accession Q5K823    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
157-188QKERVKELEKKEKERRMEMKKRRSMKKASRREBasic
NLS Segment(s)
PositionSequence
160-188RVKELEKKEKERRMEMKKRRSMKKASRRE
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_mito 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0004045  F:aminoacyl-tRNA hydrolase activity  
GO:0016150  F:translation release factor activity, codon nonspecific  
GO:0070126  P:mitochondrial translational termination  
KEGG cne:CNM00390  -  
Pfam View protein in Pfam  
PF00472  RF-1  
PROSITE View protein in PROSITE  
PS00745  RF_PROK_I  
Amino Acid Sequences MRSIRRLLSRRLLSTTACLAAKPPVKLLHIPKLGSESEHLLARQWVDAFTPEDIPKEGWVATRSRSSGPGGQHVNKTESKVTIRCDLDQAVGRWLPKFIMSALTKSTHYHHSPPSLLITSQTTRSASQNQANALSLLHQTIVSSANSLIINPTSPEQKERVKELEKKEKERRMEMKKRRSMKKASRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.37
4 0.3
5 0.26
6 0.22
7 0.27
8 0.3
9 0.27
10 0.28
11 0.28
12 0.31
13 0.38
14 0.43
15 0.45
16 0.45
17 0.45
18 0.41
19 0.41
20 0.39
21 0.33
22 0.29
23 0.23
24 0.19
25 0.21
26 0.2
27 0.17
28 0.18
29 0.17
30 0.17
31 0.13
32 0.11
33 0.1
34 0.12
35 0.13
36 0.13
37 0.15
38 0.14
39 0.15
40 0.16
41 0.16
42 0.14
43 0.14
44 0.13
45 0.12
46 0.13
47 0.14
48 0.15
49 0.18
50 0.19
51 0.19
52 0.21
53 0.21
54 0.24
55 0.24
56 0.28
57 0.29
58 0.31
59 0.33
60 0.32
61 0.34
62 0.3
63 0.31
64 0.26
65 0.23
66 0.24
67 0.24
68 0.24
69 0.27
70 0.27
71 0.26
72 0.26
73 0.24
74 0.22
75 0.22
76 0.2
77 0.16
78 0.16
79 0.15
80 0.14
81 0.13
82 0.12
83 0.09
84 0.09
85 0.07
86 0.12
87 0.13
88 0.14
89 0.15
90 0.17
91 0.17
92 0.18
93 0.2
94 0.19
95 0.21
96 0.24
97 0.25
98 0.27
99 0.27
100 0.27
101 0.28
102 0.23
103 0.21
104 0.18
105 0.19
106 0.16
107 0.17
108 0.18
109 0.16
110 0.17
111 0.19
112 0.23
113 0.24
114 0.28
115 0.29
116 0.28
117 0.28
118 0.27
119 0.25
120 0.2
121 0.16
122 0.12
123 0.1
124 0.09
125 0.07
126 0.07
127 0.07
128 0.09
129 0.08
130 0.08
131 0.08
132 0.11
133 0.11
134 0.11
135 0.11
136 0.1
137 0.1
138 0.11
139 0.13
140 0.15
141 0.16
142 0.19
143 0.23
144 0.3
145 0.33
146 0.38
147 0.44
148 0.47
149 0.54
150 0.61
151 0.67
152 0.69
153 0.74
154 0.79
155 0.79
156 0.78
157 0.8
158 0.8
159 0.8
160 0.83
161 0.84
162 0.84
163 0.86
164 0.89
165 0.89
166 0.88
167 0.88
168 0.88