Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GET0

Protein Details
Accession A0A0F4GET0   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSSSAHRNRHHQHHQSLHNSNKQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, extr 8, cyto_nucl 7, mito 2, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010636  Cerato-ulmin_hydrophobin  
IPR036686  Hydrophobin_sf  
Gene Ontology GO:0005576  C:extracellular region  
GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF06766  Hydrophobin_2  
CDD cd23508  hydrophobin_II  
Amino Acid Sequences MSSSAHRNRHHQHHQSLHNSNKQLLPLSFRHSLNHSSTPLFNYQPPTTINMQFIILALAALAAAAPSGLSSYGGSGSGMAGGHGGSGGSNGGGSNGGSNKFKCSAPLQSSLQCCQVNALGLASLPCNAPTRDIESREDFVKYCQQSGATAQCCVAPALGAGVACEEVKSNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.83
4 0.8
5 0.77
6 0.7
7 0.63
8 0.56
9 0.49
10 0.45
11 0.37
12 0.34
13 0.3
14 0.33
15 0.36
16 0.34
17 0.34
18 0.33
19 0.37
20 0.37
21 0.39
22 0.35
23 0.31
24 0.32
25 0.32
26 0.32
27 0.29
28 0.26
29 0.27
30 0.25
31 0.26
32 0.25
33 0.27
34 0.27
35 0.28
36 0.26
37 0.21
38 0.21
39 0.18
40 0.17
41 0.13
42 0.09
43 0.06
44 0.05
45 0.04
46 0.03
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.01
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.03
81 0.04
82 0.06
83 0.07
84 0.09
85 0.1
86 0.12
87 0.14
88 0.14
89 0.16
90 0.18
91 0.23
92 0.26
93 0.31
94 0.31
95 0.34
96 0.37
97 0.36
98 0.39
99 0.31
100 0.27
101 0.23
102 0.21
103 0.17
104 0.15
105 0.13
106 0.07
107 0.07
108 0.08
109 0.07
110 0.07
111 0.06
112 0.07
113 0.1
114 0.1
115 0.12
116 0.14
117 0.21
118 0.25
119 0.28
120 0.32
121 0.34
122 0.36
123 0.35
124 0.35
125 0.28
126 0.26
127 0.31
128 0.28
129 0.25
130 0.24
131 0.24
132 0.24
133 0.28
134 0.33
135 0.26
136 0.26
137 0.24
138 0.24
139 0.24
140 0.23
141 0.18
142 0.09
143 0.08
144 0.08
145 0.09
146 0.08
147 0.07
148 0.07
149 0.08
150 0.08
151 0.08