Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GFV0

Protein Details
Accession A0A0F4GFV0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-39TYSKCNERRLRDTKDRNNSRCTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046700  DUF6570  
Pfam View protein in Pfam  
PF20209  DUF6570  
Amino Acid Sequences MLLLKDFNEAVLSKEYFTYSKCNERRLRDTKDRNNSRCTSYSTKGKKAKRRDYLLNSRANNMRPGDLPALDALTDTEEMLIARVHPILKFVLTDRGVQQLYSGYVAHFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.18
4 0.19
5 0.23
6 0.23
7 0.33
8 0.36
9 0.44
10 0.5
11 0.57
12 0.65
13 0.66
14 0.71
15 0.72
16 0.79
17 0.79
18 0.83
19 0.86
20 0.8
21 0.79
22 0.73
23 0.67
24 0.6
25 0.56
26 0.52
27 0.47
28 0.52
29 0.51
30 0.57
31 0.6
32 0.65
33 0.68
34 0.71
35 0.76
36 0.75
37 0.75
38 0.75
39 0.76
40 0.78
41 0.76
42 0.73
43 0.63
44 0.58
45 0.54
46 0.47
47 0.42
48 0.32
49 0.26
50 0.19
51 0.22
52 0.2
53 0.17
54 0.16
55 0.13
56 0.12
57 0.1
58 0.1
59 0.07
60 0.06
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.05
69 0.05
70 0.07
71 0.08
72 0.08
73 0.1
74 0.1
75 0.11
76 0.12
77 0.12
78 0.19
79 0.2
80 0.22
81 0.22
82 0.27
83 0.27
84 0.26
85 0.25
86 0.19
87 0.19
88 0.18
89 0.17