Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4GBK1

Protein Details
Accession A0A0F4GBK1    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
126-158LAFAEKKEKKDKKDKKDKKAKKPPKSTSNEPMIBasic
NLS Segment(s)
PositionSequence
21-26KKSKSS
131-150KKEKKDKKDKKDKKAKKPPK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
Amino Acid Sequences MPSDNDPRDRSASPARDSGAKKSKSSGSSGGFKWKSKAPRDEAADDSRNSGRLERGYRDRSPMRDTFRDRDGDHSGAPTRRDDDREDRRDDRFSSSGAGRDSSRSQRREDDGARKEDDPEQPSDSLAFAEKKEKKDKKDKKDKKAKKPPKSTSNEPMIVVNINDRLGTKAAIPCLASDSVKAFKAIVAANIGRQPHEIMLKRQGERPFKDQLTLEDYGVSHGVQLDLELDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.47
4 0.49
5 0.53
6 0.53
7 0.5
8 0.47
9 0.48
10 0.53
11 0.48
12 0.5
13 0.48
14 0.43
15 0.46
16 0.46
17 0.51
18 0.48
19 0.47
20 0.46
21 0.45
22 0.49
23 0.51
24 0.58
25 0.54
26 0.58
27 0.63
28 0.64
29 0.62
30 0.6
31 0.56
32 0.48
33 0.45
34 0.38
35 0.34
36 0.3
37 0.27
38 0.23
39 0.24
40 0.29
41 0.31
42 0.39
43 0.43
44 0.44
45 0.5
46 0.52
47 0.5
48 0.52
49 0.52
50 0.5
51 0.52
52 0.56
53 0.53
54 0.52
55 0.52
56 0.47
57 0.46
58 0.43
59 0.37
60 0.31
61 0.29
62 0.29
63 0.28
64 0.28
65 0.25
66 0.22
67 0.23
68 0.25
69 0.28
70 0.33
71 0.41
72 0.46
73 0.5
74 0.51
75 0.51
76 0.52
77 0.48
78 0.44
79 0.34
80 0.29
81 0.25
82 0.23
83 0.23
84 0.2
85 0.2
86 0.15
87 0.16
88 0.2
89 0.26
90 0.32
91 0.31
92 0.33
93 0.36
94 0.39
95 0.42
96 0.44
97 0.45
98 0.42
99 0.44
100 0.44
101 0.39
102 0.38
103 0.36
104 0.35
105 0.28
106 0.25
107 0.23
108 0.21
109 0.21
110 0.19
111 0.15
112 0.11
113 0.11
114 0.1
115 0.08
116 0.17
117 0.21
118 0.26
119 0.36
120 0.42
121 0.48
122 0.58
123 0.67
124 0.7
125 0.77
126 0.83
127 0.83
128 0.89
129 0.92
130 0.92
131 0.94
132 0.93
133 0.93
134 0.93
135 0.92
136 0.91
137 0.89
138 0.85
139 0.81
140 0.78
141 0.69
142 0.59
143 0.5
144 0.4
145 0.33
146 0.25
147 0.19
148 0.12
149 0.1
150 0.1
151 0.1
152 0.1
153 0.1
154 0.11
155 0.12
156 0.13
157 0.14
158 0.15
159 0.15
160 0.13
161 0.15
162 0.16
163 0.14
164 0.13
165 0.15
166 0.16
167 0.17
168 0.17
169 0.14
170 0.13
171 0.16
172 0.15
173 0.14
174 0.15
175 0.15
176 0.17
177 0.2
178 0.2
179 0.18
180 0.18
181 0.18
182 0.17
183 0.24
184 0.26
185 0.28
186 0.37
187 0.43
188 0.44
189 0.49
190 0.55
191 0.56
192 0.58
193 0.57
194 0.57
195 0.51
196 0.53
197 0.49
198 0.45
199 0.42
200 0.38
201 0.34
202 0.27
203 0.25
204 0.23
205 0.22
206 0.18
207 0.12
208 0.1
209 0.1
210 0.08
211 0.08
212 0.08
213 0.07