Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GPN2

Protein Details
Accession A0A0F4GPN2   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-116TEEQIRHKAKLRKRKEKRRAIPQANEHLNKTKKKNKKKGEQQARRDAGIBasic
NLS Segment(s)
PositionSequence
73-112RHKAKLRKRKEKRRAIPQANEHLNKTKKKNKKKGEQQARR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MNAEGDVGVNAEGDLNVDAAVKTEPDDDSTAGGGGSNAVAGSISAESAPSRRRQLIEQLPLENVPVFTEEQIRHKAKLRKRKEKRRAIPQANEHLNKTKKKNKKKGEQQARRDAGIKQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.06
5 0.06
6 0.07
7 0.07
8 0.06
9 0.07
10 0.08
11 0.09
12 0.11
13 0.12
14 0.12
15 0.12
16 0.12
17 0.12
18 0.1
19 0.09
20 0.07
21 0.05
22 0.05
23 0.04
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.07
35 0.09
36 0.12
37 0.16
38 0.18
39 0.19
40 0.21
41 0.3
42 0.35
43 0.4
44 0.38
45 0.36
46 0.35
47 0.33
48 0.32
49 0.23
50 0.15
51 0.08
52 0.07
53 0.06
54 0.06
55 0.1
56 0.11
57 0.15
58 0.22
59 0.24
60 0.24
61 0.32
62 0.39
63 0.43
64 0.53
65 0.6
66 0.64
67 0.74
68 0.84
69 0.87
70 0.9
71 0.92
72 0.93
73 0.93
74 0.91
75 0.89
76 0.86
77 0.85
78 0.83
79 0.75
80 0.67
81 0.65
82 0.63
83 0.61
84 0.62
85 0.62
86 0.64
87 0.73
88 0.81
89 0.83
90 0.87
91 0.91
92 0.93
93 0.94
94 0.94
95 0.93
96 0.94
97 0.87
98 0.79
99 0.7