Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4GA15

Protein Details
Accession A0A0F4GA15    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
367-396RSDYTEARKYRARRKKWMRKKRASVTSRRSBasic
NLS Segment(s)
PositionSequence
374-396RKYRARRKKWMRKKRASVTSRRS
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MFEIERSEYLYDLIKENKTRMDRANELLEVIMDKFVASAILYFDKAYDPSDEDEDNAFMNTAFKKYLEAVLCACSAYHLQQDFRKIKQREFLSSRDPPFSKERRRVRETYDCSMKIELACRENYEEERTRFLEDYGRKDRHPGPRGLLTEQNMAINMVPETQRYPVSQRSFESNRDSQTGRPILPDNAYVAAPAQVSQDLQNLYDLRKTFRRAEADHRNGIDKLKNAKALRMGILENLPDEHFQEHFQANLGFTLEEHEARLRESMEAAREAYHQARRAIRQDLDQLPAVSESSFAARTSDCIENGSAPGSYKGRIQRSGDPALYNWQRAAASEISANGQRESPSEPSSLYNGPSLRFGERVSPSVRSDYTEARKYRARRKKWMRKKRASVTSRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.34
4 0.41
5 0.42
6 0.46
7 0.49
8 0.52
9 0.51
10 0.53
11 0.56
12 0.48
13 0.44
14 0.38
15 0.31
16 0.24
17 0.2
18 0.15
19 0.09
20 0.08
21 0.07
22 0.07
23 0.07
24 0.05
25 0.05
26 0.08
27 0.1
28 0.11
29 0.11
30 0.11
31 0.13
32 0.13
33 0.14
34 0.14
35 0.14
36 0.17
37 0.2
38 0.2
39 0.2
40 0.2
41 0.19
42 0.17
43 0.15
44 0.13
45 0.09
46 0.12
47 0.12
48 0.12
49 0.12
50 0.12
51 0.14
52 0.15
53 0.22
54 0.2
55 0.21
56 0.21
57 0.22
58 0.23
59 0.21
60 0.19
61 0.14
62 0.13
63 0.13
64 0.18
65 0.18
66 0.21
67 0.25
68 0.35
69 0.37
70 0.42
71 0.5
72 0.47
73 0.49
74 0.54
75 0.55
76 0.55
77 0.55
78 0.55
79 0.53
80 0.58
81 0.56
82 0.55
83 0.51
84 0.46
85 0.5
86 0.55
87 0.57
88 0.59
89 0.66
90 0.68
91 0.75
92 0.75
93 0.74
94 0.76
95 0.72
96 0.71
97 0.69
98 0.61
99 0.55
100 0.52
101 0.45
102 0.35
103 0.33
104 0.28
105 0.23
106 0.22
107 0.22
108 0.24
109 0.25
110 0.25
111 0.28
112 0.3
113 0.29
114 0.32
115 0.32
116 0.32
117 0.3
118 0.28
119 0.29
120 0.27
121 0.33
122 0.38
123 0.4
124 0.37
125 0.42
126 0.49
127 0.51
128 0.53
129 0.49
130 0.45
131 0.49
132 0.51
133 0.49
134 0.46
135 0.38
136 0.35
137 0.31
138 0.27
139 0.2
140 0.17
141 0.14
142 0.11
143 0.08
144 0.07
145 0.07
146 0.07
147 0.08
148 0.1
149 0.11
150 0.11
151 0.15
152 0.21
153 0.25
154 0.27
155 0.27
156 0.33
157 0.35
158 0.37
159 0.4
160 0.35
161 0.33
162 0.33
163 0.33
164 0.27
165 0.31
166 0.3
167 0.24
168 0.23
169 0.23
170 0.21
171 0.21
172 0.21
173 0.14
174 0.13
175 0.12
176 0.1
177 0.09
178 0.08
179 0.07
180 0.07
181 0.06
182 0.05
183 0.06
184 0.07
185 0.09
186 0.08
187 0.08
188 0.1
189 0.1
190 0.1
191 0.13
192 0.13
193 0.14
194 0.17
195 0.21
196 0.23
197 0.28
198 0.32
199 0.32
200 0.41
201 0.49
202 0.51
203 0.51
204 0.47
205 0.44
206 0.4
207 0.39
208 0.33
209 0.26
210 0.26
211 0.26
212 0.32
213 0.3
214 0.31
215 0.33
216 0.31
217 0.29
218 0.25
219 0.22
220 0.17
221 0.18
222 0.16
223 0.12
224 0.11
225 0.1
226 0.08
227 0.09
228 0.09
229 0.09
230 0.09
231 0.12
232 0.12
233 0.11
234 0.12
235 0.12
236 0.11
237 0.11
238 0.1
239 0.07
240 0.07
241 0.09
242 0.09
243 0.09
244 0.09
245 0.11
246 0.1
247 0.11
248 0.13
249 0.1
250 0.1
251 0.11
252 0.12
253 0.13
254 0.14
255 0.14
256 0.13
257 0.14
258 0.16
259 0.19
260 0.21
261 0.23
262 0.26
263 0.31
264 0.34
265 0.38
266 0.41
267 0.38
268 0.37
269 0.41
270 0.39
271 0.37
272 0.35
273 0.31
274 0.25
275 0.24
276 0.21
277 0.13
278 0.11
279 0.08
280 0.08
281 0.09
282 0.08
283 0.09
284 0.09
285 0.1
286 0.14
287 0.17
288 0.15
289 0.16
290 0.16
291 0.16
292 0.17
293 0.17
294 0.12
295 0.11
296 0.14
297 0.14
298 0.14
299 0.18
300 0.25
301 0.3
302 0.36
303 0.39
304 0.44
305 0.5
306 0.56
307 0.52
308 0.46
309 0.41
310 0.45
311 0.44
312 0.37
313 0.3
314 0.26
315 0.24
316 0.23
317 0.26
318 0.18
319 0.16
320 0.16
321 0.16
322 0.16
323 0.2
324 0.21
325 0.17
326 0.18
327 0.17
328 0.18
329 0.21
330 0.23
331 0.22
332 0.22
333 0.22
334 0.23
335 0.27
336 0.27
337 0.24
338 0.25
339 0.24
340 0.24
341 0.26
342 0.26
343 0.24
344 0.24
345 0.23
346 0.27
347 0.28
348 0.32
349 0.31
350 0.33
351 0.33
352 0.37
353 0.37
354 0.33
355 0.33
356 0.38
357 0.43
358 0.48
359 0.47
360 0.47
361 0.54
362 0.59
363 0.66
364 0.68
365 0.69
366 0.72
367 0.81
368 0.87
369 0.91
370 0.94
371 0.95
372 0.95
373 0.97
374 0.96
375 0.95
376 0.94