Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GEK6

Protein Details
Accession A0A0F4GEK6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-75IEPQVEERLKRRKRPASSNDTISHydrophilic
NLS Segment(s)
PositionSequence
63-65RRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013734  TF_Nrm1/Whi5  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08528  Whi5  
Amino Acid Sequences MAASITFERPEEVATKVMRRVQVSKMTRALQDRLALANVKIQNGWQNMSLDAIEPQVEERLKRRKRPASSNDTISDSASTTSSRLQSSPLTEPLFSDDYPPRSGGSYRPKRIRTAMNPPPILAPPSIPITTAQTGRRTRTAASRQPTWKKASGLAESSPIKHIKHARLPSHNVSHLSFTEEDEPPSPEFSEDDDTDLPLTSFAANNNKTSRTTNATSPPHTPPPDRHVRHINQVSWSRTPRTSHNPDDGADLLMYLATSPSPAIGSHRIANRSNIPQPSTVIAPPSTPPCKSTPLPSSHMTPGFLGGFGAPDTPGNTFNFADFVTLTPSPAQVHWSRTPVAGGRTPGQVGTSARRRLNFEGGLMPPGGLSPVMTRGRRDGGEGLGMELGGELVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.3
4 0.35
5 0.37
6 0.4
7 0.42
8 0.44
9 0.51
10 0.52
11 0.55
12 0.56
13 0.55
14 0.56
15 0.57
16 0.53
17 0.47
18 0.45
19 0.4
20 0.35
21 0.34
22 0.3
23 0.25
24 0.29
25 0.27
26 0.25
27 0.23
28 0.22
29 0.27
30 0.28
31 0.3
32 0.25
33 0.24
34 0.23
35 0.24
36 0.23
37 0.16
38 0.14
39 0.13
40 0.1
41 0.09
42 0.1
43 0.13
44 0.15
45 0.16
46 0.23
47 0.33
48 0.41
49 0.51
50 0.6
51 0.65
52 0.73
53 0.82
54 0.84
55 0.84
56 0.83
57 0.8
58 0.72
59 0.67
60 0.58
61 0.48
62 0.38
63 0.29
64 0.22
65 0.17
66 0.14
67 0.11
68 0.14
69 0.16
70 0.17
71 0.16
72 0.18
73 0.2
74 0.24
75 0.27
76 0.29
77 0.28
78 0.27
79 0.27
80 0.29
81 0.29
82 0.24
83 0.25
84 0.24
85 0.25
86 0.27
87 0.27
88 0.23
89 0.22
90 0.23
91 0.26
92 0.33
93 0.4
94 0.47
95 0.55
96 0.58
97 0.6
98 0.65
99 0.67
100 0.63
101 0.64
102 0.64
103 0.64
104 0.62
105 0.58
106 0.54
107 0.45
108 0.4
109 0.29
110 0.21
111 0.14
112 0.17
113 0.17
114 0.15
115 0.14
116 0.17
117 0.19
118 0.22
119 0.23
120 0.28
121 0.31
122 0.34
123 0.36
124 0.33
125 0.33
126 0.38
127 0.44
128 0.44
129 0.45
130 0.5
131 0.56
132 0.62
133 0.65
134 0.61
135 0.56
136 0.5
137 0.5
138 0.48
139 0.42
140 0.37
141 0.33
142 0.33
143 0.29
144 0.29
145 0.27
146 0.24
147 0.21
148 0.24
149 0.29
150 0.3
151 0.38
152 0.44
153 0.47
154 0.52
155 0.57
156 0.58
157 0.56
158 0.52
159 0.46
160 0.39
161 0.35
162 0.28
163 0.25
164 0.2
165 0.16
166 0.18
167 0.16
168 0.16
169 0.15
170 0.17
171 0.14
172 0.15
173 0.14
174 0.1
175 0.1
176 0.11
177 0.13
178 0.12
179 0.14
180 0.13
181 0.13
182 0.13
183 0.12
184 0.1
185 0.06
186 0.07
187 0.05
188 0.05
189 0.07
190 0.13
191 0.14
192 0.17
193 0.19
194 0.2
195 0.21
196 0.23
197 0.24
198 0.23
199 0.24
200 0.26
201 0.33
202 0.35
203 0.36
204 0.38
205 0.39
206 0.4
207 0.4
208 0.38
209 0.34
210 0.38
211 0.46
212 0.44
213 0.45
214 0.48
215 0.48
216 0.55
217 0.56
218 0.51
219 0.47
220 0.51
221 0.49
222 0.45
223 0.45
224 0.39
225 0.37
226 0.37
227 0.37
228 0.4
229 0.44
230 0.44
231 0.47
232 0.46
233 0.43
234 0.43
235 0.38
236 0.29
237 0.21
238 0.16
239 0.1
240 0.08
241 0.07
242 0.04
243 0.04
244 0.03
245 0.03
246 0.03
247 0.03
248 0.04
249 0.04
250 0.08
251 0.12
252 0.14
253 0.19
254 0.23
255 0.27
256 0.28
257 0.32
258 0.34
259 0.36
260 0.39
261 0.38
262 0.36
263 0.33
264 0.33
265 0.32
266 0.28
267 0.23
268 0.2
269 0.17
270 0.16
271 0.17
272 0.22
273 0.24
274 0.22
275 0.24
276 0.25
277 0.31
278 0.31
279 0.37
280 0.38
281 0.4
282 0.44
283 0.44
284 0.45
285 0.45
286 0.45
287 0.38
288 0.31
289 0.27
290 0.23
291 0.2
292 0.16
293 0.1
294 0.09
295 0.08
296 0.08
297 0.06
298 0.06
299 0.07
300 0.09
301 0.11
302 0.11
303 0.14
304 0.14
305 0.14
306 0.15
307 0.14
308 0.13
309 0.12
310 0.11
311 0.13
312 0.13
313 0.14
314 0.13
315 0.14
316 0.15
317 0.15
318 0.2
319 0.18
320 0.25
321 0.29
322 0.32
323 0.32
324 0.31
325 0.34
326 0.32
327 0.34
328 0.31
329 0.3
330 0.29
331 0.3
332 0.3
333 0.27
334 0.24
335 0.23
336 0.22
337 0.27
338 0.33
339 0.38
340 0.41
341 0.44
342 0.49
343 0.51
344 0.56
345 0.49
346 0.42
347 0.41
348 0.38
349 0.37
350 0.32
351 0.26
352 0.18
353 0.16
354 0.15
355 0.09
356 0.08
357 0.08
358 0.16
359 0.23
360 0.25
361 0.27
362 0.32
363 0.37
364 0.37
365 0.39
366 0.34
367 0.3
368 0.33
369 0.31
370 0.27
371 0.22
372 0.21
373 0.17
374 0.13