Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4GLU8

Protein Details
Accession A0A0F4GLU8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-75KDEAKRKKADAKKDGSNKNAKVBasic
NLS Segment(s)
PositionSequence
50-71RKHLKDEAKRKKADAKKDGSNK
Subcellular Location(s) mito 21.5, cyto_mito 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004413  Apn/Gln-ADT_bsu  
IPR017959  Asn/Gln-tRNA_amidoTrfase_suB/E  
IPR006075  Asn/Gln-tRNA_Trfase_suB/E_cat  
IPR018027  Asn/Gln_amidotransferase  
IPR003789  Asn/Gln_tRNA_amidoTrase-B-like  
IPR017958  Gln-tRNA_amidoTrfase_suB_CS  
IPR014746  Gln_synth/guanido_kin_cat_dom  
Gene Ontology GO:0030956  C:glutamyl-tRNA(Gln) amidotransferase complex  
GO:0005739  C:mitochondrion  
GO:0005524  F:ATP binding  
GO:0050567  F:glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity  
GO:0016740  F:transferase activity  
GO:0070681  P:glutaminyl-tRNAGln biosynthesis via transamidation  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF02934  GatB_N  
PF02637  GatB_Yqey  
PROSITE View protein in PROSITE  
PS01234  GATB  
Amino Acid Sequences MTMRPSPLLSSLLTTRTILRAPRPCIVAKWLRSRHLSTAPISHQDAVPLRKHLKDEAKRKKADAKKDGSNKNAKVDPRQEKWELTVGIEIHAELNTASKLFSPAPADASEGNDVANSRVAMFDAAIPGTQPQFQPATLLPALRAAIALGCDVQRQSGWDRKHYFHWDQPQGYQITQYYHPFALNGSIEVTAEDGVPIADLNGAESLTIGIKQVQMEQDTAKTTGFGASTYHIDLNRAGHPLIEIITLPHIHSPKTAAAVVRKIAAIIRSVDACVAGMELGGLRADVNVSVRERGTSGICSYSGVGGLGQRTEIKNLSSFKAVEDAIVAERDRQIEVLEAGGIILGETRGWTLGVKETTRLRGKEGEVDYRYMPDADLPPLLIGADLVQHLSSTLPELPDSTVSRLQQDYGLTSKDARTLISLDDGDRLEFLEETIALIQVSSTDIDPSKVSRTAANWVLHELGGLLGPSSTWSEDMSITPAELADILMHLLTKRINARAGKSLVSILFSHPSSDPSRPTVEDLIEQNNLLLRPLTSEEYVALAKEILAEKDGVVETVRKDAKKGKEGKLMYLVGQMVRKGEEGTVEPERAKEVLGELIRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.27
5 0.27
6 0.33
7 0.4
8 0.43
9 0.48
10 0.5
11 0.48
12 0.48
13 0.52
14 0.52
15 0.51
16 0.57
17 0.59
18 0.61
19 0.65
20 0.67
21 0.65
22 0.64
23 0.61
24 0.53
25 0.54
26 0.52
27 0.52
28 0.5
29 0.44
30 0.36
31 0.37
32 0.4
33 0.37
34 0.37
35 0.38
36 0.4
37 0.42
38 0.45
39 0.48
40 0.52
41 0.57
42 0.64
43 0.68
44 0.74
45 0.74
46 0.76
47 0.78
48 0.76
49 0.77
50 0.76
51 0.72
52 0.72
53 0.78
54 0.81
55 0.8
56 0.81
57 0.74
58 0.71
59 0.69
60 0.63
61 0.62
62 0.65
63 0.65
64 0.61
65 0.65
66 0.61
67 0.57
68 0.56
69 0.54
70 0.45
71 0.37
72 0.34
73 0.27
74 0.25
75 0.23
76 0.19
77 0.13
78 0.12
79 0.11
80 0.07
81 0.08
82 0.08
83 0.08
84 0.08
85 0.08
86 0.1
87 0.11
88 0.14
89 0.16
90 0.16
91 0.18
92 0.19
93 0.2
94 0.18
95 0.2
96 0.19
97 0.16
98 0.15
99 0.13
100 0.13
101 0.12
102 0.13
103 0.1
104 0.08
105 0.09
106 0.09
107 0.09
108 0.09
109 0.09
110 0.08
111 0.08
112 0.08
113 0.08
114 0.09
115 0.1
116 0.11
117 0.1
118 0.12
119 0.13
120 0.13
121 0.16
122 0.15
123 0.2
124 0.19
125 0.2
126 0.17
127 0.17
128 0.18
129 0.15
130 0.14
131 0.08
132 0.07
133 0.07
134 0.08
135 0.06
136 0.06
137 0.07
138 0.08
139 0.08
140 0.08
141 0.1
142 0.15
143 0.21
144 0.24
145 0.32
146 0.37
147 0.39
148 0.46
149 0.52
150 0.52
151 0.52
152 0.59
153 0.59
154 0.56
155 0.54
156 0.52
157 0.46
158 0.4
159 0.35
160 0.26
161 0.22
162 0.23
163 0.23
164 0.21
165 0.2
166 0.2
167 0.18
168 0.17
169 0.17
170 0.14
171 0.13
172 0.11
173 0.1
174 0.1
175 0.1
176 0.1
177 0.06
178 0.06
179 0.05
180 0.04
181 0.04
182 0.04
183 0.04
184 0.03
185 0.04
186 0.04
187 0.04
188 0.05
189 0.05
190 0.04
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.07
198 0.07
199 0.09
200 0.11
201 0.12
202 0.13
203 0.13
204 0.14
205 0.15
206 0.15
207 0.13
208 0.11
209 0.1
210 0.1
211 0.1
212 0.08
213 0.08
214 0.08
215 0.1
216 0.11
217 0.12
218 0.11
219 0.12
220 0.12
221 0.14
222 0.15
223 0.15
224 0.13
225 0.12
226 0.12
227 0.11
228 0.11
229 0.08
230 0.06
231 0.05
232 0.07
233 0.07
234 0.07
235 0.1
236 0.1
237 0.1
238 0.11
239 0.13
240 0.13
241 0.15
242 0.16
243 0.14
244 0.16
245 0.19
246 0.19
247 0.17
248 0.16
249 0.14
250 0.13
251 0.12
252 0.11
253 0.1
254 0.1
255 0.09
256 0.09
257 0.09
258 0.08
259 0.07
260 0.06
261 0.04
262 0.03
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.02
270 0.02
271 0.03
272 0.03
273 0.04
274 0.06
275 0.07
276 0.08
277 0.08
278 0.08
279 0.09
280 0.1
281 0.1
282 0.09
283 0.09
284 0.09
285 0.09
286 0.09
287 0.09
288 0.08
289 0.07
290 0.06
291 0.05
292 0.05
293 0.05
294 0.05
295 0.05
296 0.07
297 0.07
298 0.09
299 0.09
300 0.09
301 0.13
302 0.15
303 0.16
304 0.16
305 0.16
306 0.15
307 0.17
308 0.16
309 0.12
310 0.1
311 0.1
312 0.08
313 0.09
314 0.09
315 0.07
316 0.08
317 0.09
318 0.08
319 0.08
320 0.08
321 0.07
322 0.07
323 0.07
324 0.06
325 0.05
326 0.04
327 0.04
328 0.04
329 0.03
330 0.03
331 0.02
332 0.02
333 0.02
334 0.03
335 0.03
336 0.03
337 0.04
338 0.04
339 0.09
340 0.11
341 0.12
342 0.15
343 0.17
344 0.24
345 0.29
346 0.29
347 0.27
348 0.29
349 0.3
350 0.35
351 0.35
352 0.36
353 0.32
354 0.34
355 0.31
356 0.28
357 0.27
358 0.2
359 0.17
360 0.11
361 0.12
362 0.11
363 0.11
364 0.1
365 0.09
366 0.09
367 0.09
368 0.06
369 0.05
370 0.03
371 0.04
372 0.04
373 0.04
374 0.04
375 0.04
376 0.05
377 0.05
378 0.05
379 0.06
380 0.07
381 0.07
382 0.07
383 0.09
384 0.09
385 0.12
386 0.14
387 0.16
388 0.18
389 0.18
390 0.21
391 0.2
392 0.2
393 0.19
394 0.18
395 0.17
396 0.15
397 0.16
398 0.14
399 0.15
400 0.15
401 0.17
402 0.16
403 0.14
404 0.14
405 0.14
406 0.14
407 0.16
408 0.15
409 0.12
410 0.15
411 0.15
412 0.13
413 0.12
414 0.12
415 0.09
416 0.09
417 0.08
418 0.06
419 0.06
420 0.06
421 0.06
422 0.06
423 0.05
424 0.05
425 0.05
426 0.04
427 0.05
428 0.05
429 0.05
430 0.07
431 0.07
432 0.09
433 0.1
434 0.11
435 0.14
436 0.16
437 0.17
438 0.17
439 0.19
440 0.24
441 0.3
442 0.31
443 0.28
444 0.27
445 0.28
446 0.25
447 0.23
448 0.17
449 0.1
450 0.08
451 0.07
452 0.05
453 0.04
454 0.04
455 0.05
456 0.06
457 0.07
458 0.07
459 0.07
460 0.09
461 0.1
462 0.11
463 0.12
464 0.11
465 0.11
466 0.1
467 0.09
468 0.08
469 0.07
470 0.07
471 0.04
472 0.04
473 0.05
474 0.04
475 0.05
476 0.05
477 0.07
478 0.07
479 0.11
480 0.15
481 0.18
482 0.24
483 0.27
484 0.32
485 0.38
486 0.4
487 0.37
488 0.35
489 0.35
490 0.29
491 0.27
492 0.24
493 0.19
494 0.2
495 0.19
496 0.2
497 0.18
498 0.21
499 0.23
500 0.26
501 0.27
502 0.27
503 0.31
504 0.3
505 0.33
506 0.33
507 0.3
508 0.3
509 0.3
510 0.31
511 0.28
512 0.26
513 0.22
514 0.22
515 0.2
516 0.17
517 0.15
518 0.1
519 0.12
520 0.16
521 0.18
522 0.16
523 0.17
524 0.16
525 0.18
526 0.18
527 0.15
528 0.13
529 0.1
530 0.09
531 0.12
532 0.13
533 0.11
534 0.12
535 0.12
536 0.12
537 0.15
538 0.15
539 0.12
540 0.12
541 0.14
542 0.14
543 0.23
544 0.28
545 0.25
546 0.29
547 0.37
548 0.45
549 0.52
550 0.6
551 0.6
552 0.65
553 0.66
554 0.68
555 0.68
556 0.6
557 0.52
558 0.47
559 0.4
560 0.33
561 0.34
562 0.29
563 0.23
564 0.22
565 0.22
566 0.19
567 0.17
568 0.17
569 0.18
570 0.23
571 0.26
572 0.27
573 0.27
574 0.26
575 0.28
576 0.25
577 0.23
578 0.17
579 0.15
580 0.2