Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GER0

Protein Details
Accession A0A0F4GER0    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
125-148QPSPNEPPPKRKRGRPTKAEAQAKHydrophilic
NLS Segment(s)
PositionSequence
132-143PPKRKRGRPTKA
227-227R
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MATPPEQPWTIHEKNYLLAEIIKGAYPTPDVLLNLVRHMNVKPRWDDIPLPLGRSLNSCKAVYEELWRSHSMQSMAMPYTPTPLSAPMQPHKRPYQFEGSYSAGPSNREIRPRPAVVAGGAFYQQPSPNEPPPKRKRGRPTKAEAQAKAEAAAAMSGGDPGSATTSRSATQAAATFPPPPNPATSMRTEEPKPTTTVAARMPIAAMLTPNPQDKSSSHSGSSSGKRRRARSTKAEQDEFGTSREGAGQGGSRYESPFGRPGPEADDPPARTAVLRHREGHPDLLRAASPHPSSTTSAAPPSFHAHGQPRPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.34
4 0.26
5 0.23
6 0.2
7 0.18
8 0.17
9 0.15
10 0.13
11 0.12
12 0.12
13 0.12
14 0.12
15 0.11
16 0.13
17 0.12
18 0.14
19 0.19
20 0.18
21 0.2
22 0.21
23 0.2
24 0.2
25 0.21
26 0.29
27 0.28
28 0.34
29 0.34
30 0.37
31 0.38
32 0.4
33 0.41
34 0.36
35 0.41
36 0.35
37 0.35
38 0.33
39 0.31
40 0.28
41 0.3
42 0.3
43 0.28
44 0.31
45 0.28
46 0.27
47 0.29
48 0.3
49 0.27
50 0.3
51 0.29
52 0.29
53 0.32
54 0.33
55 0.33
56 0.32
57 0.34
58 0.28
59 0.23
60 0.21
61 0.21
62 0.2
63 0.19
64 0.18
65 0.15
66 0.17
67 0.15
68 0.14
69 0.12
70 0.14
71 0.15
72 0.18
73 0.23
74 0.27
75 0.36
76 0.38
77 0.44
78 0.5
79 0.54
80 0.53
81 0.53
82 0.56
83 0.48
84 0.47
85 0.46
86 0.4
87 0.36
88 0.33
89 0.3
90 0.21
91 0.2
92 0.21
93 0.21
94 0.21
95 0.26
96 0.28
97 0.32
98 0.37
99 0.37
100 0.37
101 0.32
102 0.3
103 0.24
104 0.22
105 0.17
106 0.11
107 0.1
108 0.09
109 0.07
110 0.08
111 0.1
112 0.1
113 0.14
114 0.18
115 0.24
116 0.34
117 0.37
118 0.47
119 0.54
120 0.64
121 0.64
122 0.68
123 0.73
124 0.75
125 0.81
126 0.79
127 0.78
128 0.77
129 0.81
130 0.79
131 0.69
132 0.63
133 0.55
134 0.46
135 0.38
136 0.29
137 0.19
138 0.13
139 0.11
140 0.06
141 0.04
142 0.04
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.05
149 0.05
150 0.05
151 0.06
152 0.08
153 0.08
154 0.09
155 0.1
156 0.08
157 0.1
158 0.11
159 0.11
160 0.11
161 0.11
162 0.14
163 0.14
164 0.16
165 0.16
166 0.16
167 0.16
168 0.18
169 0.21
170 0.21
171 0.24
172 0.26
173 0.26
174 0.3
175 0.3
176 0.31
177 0.31
178 0.29
179 0.28
180 0.24
181 0.25
182 0.21
183 0.24
184 0.21
185 0.21
186 0.19
187 0.17
188 0.16
189 0.14
190 0.13
191 0.1
192 0.08
193 0.06
194 0.09
195 0.11
196 0.14
197 0.15
198 0.15
199 0.17
200 0.17
201 0.22
202 0.27
203 0.27
204 0.25
205 0.25
206 0.27
207 0.31
208 0.38
209 0.41
210 0.43
211 0.48
212 0.54
213 0.59
214 0.68
215 0.71
216 0.72
217 0.73
218 0.75
219 0.78
220 0.79
221 0.76
222 0.66
223 0.6
224 0.56
225 0.47
226 0.37
227 0.28
228 0.2
229 0.17
230 0.18
231 0.15
232 0.1
233 0.1
234 0.11
235 0.1
236 0.11
237 0.13
238 0.12
239 0.13
240 0.16
241 0.16
242 0.17
243 0.22
244 0.22
245 0.24
246 0.24
247 0.24
248 0.28
249 0.31
250 0.29
251 0.28
252 0.34
253 0.32
254 0.33
255 0.33
256 0.27
257 0.24
258 0.25
259 0.31
260 0.33
261 0.36
262 0.37
263 0.4
264 0.48
265 0.5
266 0.55
267 0.49
268 0.43
269 0.39
270 0.38
271 0.35
272 0.29
273 0.29
274 0.27
275 0.25
276 0.23
277 0.25
278 0.26
279 0.28
280 0.3
281 0.32
282 0.28
283 0.32
284 0.31
285 0.3
286 0.3
287 0.32
288 0.32
289 0.29
290 0.33
291 0.35