Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GM08

Protein Details
Accession A0A0F4GM08   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-119MDPSKPRRSKREVQRRKSAQALKFERKSNKKPRNQVSFPSHPRKKKAGKKBasic
NLS Segment(s)
PositionSequence
74-119KPRRSKREVQRRKSAQALKFERKSNKKPRNQVSFPSHPRKKKAGKK
Subcellular Location(s) nucl 14, mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MARSARSSGIKKNKAVLKKRVFGPVETARNERMNAKLLELASAPREKMEVEETKPEEEKAAENADEDVDMDPSKPRRSKREVQRRKSAQALKFERKSNKKPRNQVSFPSHPRKKKAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.71
4 0.69
5 0.7
6 0.71
7 0.72
8 0.67
9 0.58
10 0.57
11 0.55
12 0.52
13 0.48
14 0.47
15 0.41
16 0.41
17 0.41
18 0.35
19 0.29
20 0.27
21 0.24
22 0.23
23 0.23
24 0.2
25 0.2
26 0.18
27 0.16
28 0.14
29 0.15
30 0.13
31 0.1
32 0.11
33 0.1
34 0.11
35 0.15
36 0.16
37 0.16
38 0.22
39 0.24
40 0.25
41 0.25
42 0.24
43 0.19
44 0.16
45 0.15
46 0.11
47 0.11
48 0.1
49 0.09
50 0.1
51 0.09
52 0.08
53 0.08
54 0.06
55 0.05
56 0.06
57 0.06
58 0.09
59 0.12
60 0.18
61 0.22
62 0.27
63 0.35
64 0.43
65 0.53
66 0.61
67 0.7
68 0.74
69 0.78
70 0.84
71 0.83
72 0.8
73 0.79
74 0.76
75 0.7
76 0.69
77 0.7
78 0.69
79 0.68
80 0.7
81 0.71
82 0.72
83 0.77
84 0.78
85 0.8
86 0.8
87 0.85
88 0.87
89 0.88
90 0.84
91 0.83
92 0.81
93 0.81
94 0.81
95 0.82
96 0.81
97 0.78
98 0.8
99 0.81