Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KGL3

Protein Details
Accession Q5KGL3    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
201-226AYLKNIAKRKCGKQSKKEADEKRILGHydrophilic
NLS Segment(s)
PositionSequence
91-94KRRK
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MTTFREQDFSNGPAMAQAIGRHLPQAMTDLIEIMNKINWLNSCLRSSRAVARCYQKAFVSVMEDMEELKVQMSALERANNIQGIEEDRMRKRRKTSAWPKNRELEDWVHANVRRIIDMPPSGDKSLYSKDKWPNYDPEEAPNGYVEDPESRKVLWRPNWENLRNAFFGNLVDVAVKACEDDRKSLKLECPSTEETRDRVVAYLKNIAKRKCGKQSKKEADEKRILGRTRTVSVSGSRKTGSHSLSANAARRLMTLCRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.13
4 0.12
5 0.13
6 0.15
7 0.15
8 0.15
9 0.15
10 0.14
11 0.14
12 0.16
13 0.13
14 0.12
15 0.12
16 0.12
17 0.11
18 0.12
19 0.12
20 0.1
21 0.1
22 0.09
23 0.1
24 0.12
25 0.12
26 0.15
27 0.2
28 0.22
29 0.25
30 0.26
31 0.28
32 0.28
33 0.31
34 0.36
35 0.38
36 0.37
37 0.4
38 0.46
39 0.49
40 0.49
41 0.49
42 0.4
43 0.36
44 0.35
45 0.29
46 0.26
47 0.2
48 0.18
49 0.16
50 0.15
51 0.13
52 0.12
53 0.11
54 0.07
55 0.07
56 0.06
57 0.05
58 0.06
59 0.08
60 0.1
61 0.12
62 0.14
63 0.14
64 0.15
65 0.17
66 0.16
67 0.14
68 0.12
69 0.11
70 0.12
71 0.14
72 0.15
73 0.19
74 0.23
75 0.32
76 0.36
77 0.4
78 0.43
79 0.5
80 0.55
81 0.61
82 0.68
83 0.7
84 0.76
85 0.8
86 0.78
87 0.77
88 0.71
89 0.61
90 0.53
91 0.46
92 0.38
93 0.32
94 0.28
95 0.24
96 0.24
97 0.24
98 0.23
99 0.2
100 0.17
101 0.16
102 0.16
103 0.16
104 0.16
105 0.15
106 0.15
107 0.17
108 0.17
109 0.16
110 0.15
111 0.15
112 0.19
113 0.22
114 0.2
115 0.25
116 0.31
117 0.36
118 0.4
119 0.4
120 0.41
121 0.41
122 0.46
123 0.4
124 0.36
125 0.35
126 0.31
127 0.28
128 0.22
129 0.19
130 0.13
131 0.12
132 0.1
133 0.1
134 0.11
135 0.12
136 0.12
137 0.11
138 0.15
139 0.18
140 0.26
141 0.29
142 0.38
143 0.42
144 0.5
145 0.59
146 0.57
147 0.59
148 0.54
149 0.51
150 0.42
151 0.37
152 0.29
153 0.2
154 0.18
155 0.14
156 0.11
157 0.07
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.04
164 0.05
165 0.09
166 0.11
167 0.16
168 0.2
169 0.23
170 0.25
171 0.28
172 0.32
173 0.36
174 0.38
175 0.34
176 0.37
177 0.39
178 0.4
179 0.43
180 0.4
181 0.34
182 0.34
183 0.34
184 0.28
185 0.24
186 0.25
187 0.22
188 0.23
189 0.29
190 0.3
191 0.36
192 0.42
193 0.42
194 0.47
195 0.53
196 0.58
197 0.61
198 0.69
199 0.71
200 0.76
201 0.85
202 0.87
203 0.88
204 0.9
205 0.87
206 0.85
207 0.83
208 0.77
209 0.73
210 0.7
211 0.63
212 0.56
213 0.54
214 0.5
215 0.45
216 0.44
217 0.38
218 0.33
219 0.37
220 0.42
221 0.38
222 0.37
223 0.34
224 0.32
225 0.36
226 0.4
227 0.35
228 0.33
229 0.32
230 0.31
231 0.36
232 0.42
233 0.42
234 0.38
235 0.37
236 0.32
237 0.31
238 0.32